KEGG   Amycolatopsis methanolica: AMETH_3638Help
Entry
AMETH_3638        CDS       T03230                                 

Gene name
adh
Definition
(GenBank) alcohol dehydrogenase GroES domain-containing protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
amq  Amycolatopsis methanolica
Pathway
amq00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:amq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AMETH_3638 (adh)
Enzymes [BR:amq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AMETH_3638 (adh)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AMETH_3638 (adh)
    1.1.1.-  
     AMETH_3638 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 Pyr_redox TrkA_N Pyr_redox_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AIJ23730
UniProt: A0A076MYF4
Position
3758595..3759665
Genome map
AA seq 356 aa AA seqDB search
MKAARFHGPGDIRIDEVPDPRVGPGQVEVSVDWCGICGTDLHEYLEGPIFIPPAGSPHPL
TGVGLPVVMGHEFAGVVSAVGPGVTGIAEGDRVAVEPYHVCGKCAACQAGRYNICRNLGF
IGLSGNEGGFAERCVVDQRWIHQLGDLPTDIGALVEPLAVGYHAVRLSGIPEGGTAAVYG
AGPIGLVTAAALKARGAGRVIVVEPAAARKAKAGPAGADVIIDPTTDDATEAIRDLTEGA
GADVAFECAGIDAVLASAISSVRPGGTVVNVAIWGHVPRVTVNDLVMSEINLVGSLAYCG
DHAGTIALLREGKVDASKFITGRIALDDLVDGGFRELIDNKEDNVKILVSPRERLA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgcacggttccacggtcccggcgacatccggatcgacgaggtgcccgacccg
cgggtggggccagggcaggtggaggtctcggtcgactggtgcggcatctgcggcaccgac
ctgcacgaatacctggaaggcccgatcttcatcccgccggccggatcaccacacccgctc
accggggtcgggctgcccgtggtgatgggccacgagttcgcgggcgtggtgtccgcggtc
gggccgggcgtcaccggcatcgccgaaggcgaccgtgtggccgtcgagccctaccacgtg
tgcggcaagtgcgccgcctgccaggccgggcgctacaacatctgccgcaacctcggcttc
atcggcctgtccggcaacgagggcggcttcgccgaacggtgtgtggtcgaccagcgatgg
atccaccagctcggcgacctgcccacggacatcggcgccctggtcgaaccactggccgtg
ggctaccacgcggtgcggctgtccgggatccccgagggcggcaccgcggccgtgtacggc
gccggccccatcggtctcgtcaccgccgccgcgctcaaggctcgcggcgccggccgggtg
attgtggtggaaccggccgccgcccgcaaggcgaaggccggccccgcgggcgcggacgtc
atcatcgaccccaccaccgacgacgcgaccgaggcgatccgggacctgaccgagggggcg
ggcgccgacgtggcgttcgaatgcgccggcatcgacgcggtcctggcctcggcgatctcg
tcggtgcgccccggcgggaccgtggtcaacgtcgcgatctggggccacgtgccgcgggtg
acggtcaacgacctggtgatgagcgagatcaacctggtcggttcgctggcctattgcggc
gaccacgccggcacgatcgcgctgctgcgcgagggcaaggtcgacgcgtcgaagttcatc
accggccggatcgccctcgacgacctggtcgacggcgggttccgggagctgatcgacaac
aaggaggacaacgtcaagatcctcgtctcgccccgggagcggctcgcctga

DBGET integrated database retrieval system