KEGG   Amycolatopsis methanolica: AMETH_4582Help
Entry
AMETH_4582        CDS       T03230                                 

Definition
(GenBank) caprolactone hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
amq  Amycolatopsis methanolica
Pathway
amq00903  Limonene and pinene degradation
amq00930  Caprolactam degradation
amq01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:amq00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AMETH_4582
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    AMETH_4582
Enzymes [BR:amq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     AMETH_4582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3
Motif
Other DBs
NCBI-ProteinID: AIJ24674
UniProt: A0A076MVD9
Position
complement(4715247..4715471)
Genome map
AA seq 74 aa AA seqDB search
MPGIWASPAGADTSQVLLDTHGGGFVVGSAASHRKLAAHVAKALGVTAFVLDYRRAPGHP
HPRRSRTGSRCSPG
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
gtgcccggaatctgggcatcgcccgccggtgccgacacctcgcaggtcctgctcgacacc
cacggtggcggcttcgtcgtcgggtcggcggccagccaccgcaagctcgcggcgcacgtc
gccaaggcgctcggcgtcaccgctttcgtgctcgactaccgccgcgcgcccggacacccg
cacccccgcaggtcgaggacggggtcgcggtgttcaccgggctga

DBGET integrated database retrieval system