KEGG   Amycolatopsis methanolica: AMETH_5648Help
Entry
AMETH_5648        CDS       T03230                                 

Definition
(GenBank) Pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
amq  Amycolatopsis methanolica
Pathway
amq00790  Folate biosynthesis
amq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AMETH_5648
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amq04147]
    AMETH_5648
Enzymes [BR:amq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     AMETH_5648
Exosome [BR:amq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMETH_5648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase_6
Motif
Other DBs
NCBI-ProteinID: AIJ25740
UniProt: A0A076N4L4
Position
5816878..5817351
Genome map
AA seq 157 aa AA seqDB search
MAVDIRPGRVRLVLAPVTAREIDVARRISELVRDVGYEPSPGDAQVLEIAIDTLAASRIV
PFWRAVVDYVDGPRPPEVVDPRGQGPSIWFQQMDSPRPQRNRMHIDVSVPHDEAPRQIEA
ALAARGVLRSDEAAPAFWVLADAEGNEACITTWQGRD
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
gtggcggtcgacatccggccgggtcgcgtacggctggtgctcgccccggtgaccgcgcgg
gagatcgacgtggcccggcgcatctccgagctggtccgggatgtgggttacgagccatcg
ccgggggacgcgcaggtgctggaaatcgcgatcgacacgctcgccgcttcgcggatcgtg
ccgttctggcgggcggtggtggactacgtcgacggcccgcggccgcccgaggtggtcgac
ccgcgggggcaggggccgtcgatctggttccagcagatggactccccgcgcccccagcgt
aaccggatgcacatcgacgtgtccgtcccccacgacgaggcgccgcgccagatcgaagcc
gcgctcgccgccaggggcgtcctgcgctccgacgaggcggcaccggcattctgggtactg
gccgacgccgaggggaacgaagcctgcatcacgacctggcaggggcgggactga

DBGET integrated database retrieval system