KEGG   Amycolatopsis methanolica: AMETH_6864Help
Entry
AMETH_6864        CDS       T03230                                 

Gene name
ltaA
Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
amq  Amycolatopsis methanolica
Pathway
amq00260  Glycine, serine and threonine metabolism
amq01100  Metabolic pathways
amq01110  Biosynthesis of secondary metabolites
amq01120  Microbial metabolism in diverse environments
amq01130  Biosynthesis of antibiotics
amq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMETH_6864 (ltaA)
Enzymes [BR:amq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AMETH_6864 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AIJ26956
UniProt: A0A076N6K5
Position
complement(7023362..7024396)
Genome map
AA seq 344 aa AA seqDB search
MTSAATQLIDFRSDTVTRPDEQMRRAMASAEVGDNVIDVDPTVRELEERAAAVLGMPAAL
WTPSGTMANLIALSVHLKRGDRFLAPNNAHVLNNELGSAAWLAGGMPEALPHDGGLGRPK
PETVAAAIGTRSGPYYALRTTLLCLENTHNAAGGAVIPPHEHAQLLSTARQAGLQVHLDG
ARVWHAAVALGLPPAALTVGVDSVSACFSKGLGAPAGSVVAGSREFVERARRMRQMLGGG
MRQIGVLAAACLVALDRVPDLAAEHEKARRLADGLRELGWQADTPETNIVLAPVADIAVT
LESLQAQGVLALPMAGKVRFVLHRDVSPADVDEALRRIKAGGHP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcagcagccacccagttgatcgacttccgctctgacaccgtcactcgtccggat
gagcagatgcgcagagcgatggcgtccgctgaggtcggcgacaacgtgatcgacgtcgac
ccgacagtccgcgagctcgaggagcgcgcggccgcggtcctcggcatgccggcggcgctg
tggacgccgagcggcacgatggccaacctcatcgccctgtccgtccacctcaagcgcggc
gaccgcttcctcgccccgaacaacgcgcacgtcctgaacaacgagctgggctccgcggcc
tggctcgccggtggcatgccggaagcgctgccgcacgacggcggcctcgggcggcccaag
ccggagacggtcgcggcggccatcggcacccgcagcgggccgtactacgcgctgcgcacg
accctgctgtgcctggagaacacccacaatgcggcaggcggcgcggtcatcccgccgcac
gagcacgcccagctgctgtccaccgcacggcaggccgggctgcaggtccacctggacggc
gcccgcgtctggcacgcggctgtcgcgctcggcctgccgcccgccgcgctgaccgtgggc
gtggacagcgtgtcggcgtgcttcagcaaggggctgggcgcgccggccgggtcggtcgtc
gcgggcagccgggagttcgtggagcgggcgcgccggatgcggcagatgctcggcggcggc
atgcggcagatcggggtgctcgccgcggcctgcctggtcgcgctggaccgggttccggac
ctcgccgcggagcacgagaaggcccggcggctggccgacgggctgcgtgagctgggctgg
caggccgacaccccggagaccaacatcgtcctcgcgccggtcgccgacatcgcggtgacc
ctggagtcgctgcaggcccagggcgtgctggcgctgccgatggccggcaaggtgcggttc
gtgctgcaccgggacgtctcgccggccgacgtggacgaggcgctgcgccgcatcaaggcc
ggcggtcacccgtga

DBGET integrated database retrieval system