KEGG   Acaryochloris marina: AM1_0469Help
Entry
AM1_0469          CDS       T00617                                 

Definition
(GenBank) two-component hybrid histidine kinase sensor and regulator
Organism
amr  Acaryochloris marina
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg PAS PAS_9 HisKA PAS_8 PAS_4 PAS_3 DUF4659
Motif
Other DBs
NCBI-ProteinID: ABW25525
UniProt: B0CBY3
Position
447139..449445
Genome map
AA seq 768 aa AA seqDB search
MTEDFVTSSPQHSQSWQQAILDSADFVIVSTDINGLIQTLNAGALKQFGYSPEEIIDRVT
PIIFHDPEEVEQRAQVLSHELGHAIEPGMETLIVKARMGMVDENIWTLIRKDHSRFPVRL
SVTALRNDLGHLTGFLGIGKDITAQQAAEASLVESEARFSAAFQNAPIGMALVSPSGQCL
RVNHALAHLLGYPQTKLMDLILTEMIHPKDRSIEETNRLRLVAREIGNYCLELRCLHQQG
HEVWVLMNVSLVNGQEVYPPYCIVQVQDITRRKQAEAQLQRLNANLEQLVEERTRQLKEA
IETTEIANQAKSRFIANMSHEFRTPLNGIMGFSQLLLQDRRITSDQQSNLNVILRSGEHL
LSLVNEVITLSKIEAGMLAYESKDVNLHHLCEGVEDLLSLQANSKDIQFQIHIAPDVPQY
VRTDAKKLRQILINLLGNALKFTKRGSVVCQVQWRPSAPERSAHELHFIIQDTGPGIPGH
LLPQLFEPFAQDPLNRETFGGIGLGLTICQRFIHLMKGDISIESVEGQGTTVSFYIQVES
GEPVLEPAISETTVEGLAENTPSYRVLVVEDYPDNREILLMMLEVVGFEVKEAVNGQEAV
DLNRTWQPHLIWMDLQLPVLNGLEATQLIKSQNPNPPVIIAITAQALESDEVKALKAGCD
DYLRKPYQAAQVFEKMAQHLDITYRYKTSNSSHTSADPISLSADELANMPPSWIQLLYDA
AIMLDEDMLDLLLRDIPDDQHSLKSSLEYLMATYQYDVIMEKAQAVLR
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagactttgtaacctcatcgcctcagcattcacagtcctggcagcaagccatt
ctagatagtgccgatttcgttattgtttcaacagatattaatgggttaattcaaacccta
aatgcaggagcattaaaacaatttggctattcacctgaggaaatcattgatagagtcacc
ccaatcatctttcatgacccagaagaagtcgagcagcgggcgcaagtcctctcccatgag
ttgggccatgccattgaaccaggtatggagacccttatcgtcaaagcacgtatggggatg
gtcgatgaaaatatctggaccttgattcgcaaagatcacagtcggttccccgttcgctta
tctgttacagcacttaggaatgatttaggccatttaacagggtttctcgggattggcaaa
gatattactgcgcaacaagctgctgaagcctctctagtcgaaagcgaagcgcgattctca
gccgcgtttcaaaatgctcctataggcatggctttagtgtctcccagtggtcagtgccta
agagtgaatcatgccctagctcatttactgggatatccccaaaccaaactgatggatctc
atcctcactgagatgatccatcccaaagatcgatccatagaagaaacgaaccgactacga
cttgttgcaagagagattggcaactactgcttagagctacgctgtcttcatcagcagggg
catgaggtatgggttttgatgaatgtatctctggtcaatggccaagaggtttaccctccc
tactgcattgtccaagtacaagatattaccaggcgcaaacaagcagaagcacaactccag
cgcctcaacgccaatctggagcaactggttgaggaacggactcgccaactcaaagaagcg
attgaaaccactgaaatcgccaatcaagccaaaagccgatttatcgccaatatgagccat
gagtttcgcacgcctctcaacggcatcatgggttttagtcaactcttgcttcaagatcgt
cgcattacgtcagatcagcaatctaacctcaatgtcatccttcgcagtggtgagcactta
ctctcgctggtcaacgaagtcattaccctctccaagattgaagcaggaatgcttgcctat
gagtccaaagatgtcaatctgcaccatctttgtgagggggtggaagacttattatcccta
caggcgaattccaaagacattcagtttcaaattcatatcgctcctgacgttccccaatac
gtgagaacagatgctaaaaaactacggcaaatcttgattaacttactgggtaatgccttg
aagtttacgaaacgaggcagtgtcgtgtgtcaggtgcagtggcggccttcggcaccggag
cgctctgcccatgaattacatttcatcattcaagatacaggtccagggattcctgggcat
ttactacctcaactttttgaaccctttgctcaagacccgttgaatcgtgagacatttggt
ggcattggcttggggctaaccatttgccaaagatttatccatctgatgaagggggacatt
tccattgagagtgttgaggggcaaggaacaaccgttagtttttacattcaagttgaatca
ggtgagcctgttctagaaccagcaatatctgagacaaccgttgagggtcttgcagagaat
actccctcctatcgcgttttagtcgtagaagattatcctgataaccgcgagattttgctc
atgatgcttgaagtagtggggtttgaggtcaaagaggctgtgaatggccaagaggcagtg
gaccttaaccgaacatggcaaccccatttaatttggatggatttacagctgcctgtatta
aatggcctggaggctactcaattaatcaaatcccagaatccaaatccacctgtcatcatt
gccatcaccgcccaggcgctggaatctgacgaagtgaaagcgctcaaagctgggtgcgat
gactatcttcgtaaaccctatcaagccgctcaagtttttgagaaaatggctcaacattta
gatatcacctatcgttataaaacgtccaattcatctcatacttcagcagatccgatttct
ctctcggcagatgagttagccaacatgcccccttcctggatacagcttctgtatgatgct
gccattatgttggatgaagatatgcttgatctcttgcttagagacattcctgatgaccag
cactcccttaaatcttctttggagtatctaatggccacttatcaatatgacgtcattatg
gagaaggctcaagcggttttgagatag

DBGET integrated database retrieval system