KEGG   Acaryochloris marina: AM1_1050Help
Entry
AM1_1050          CDS       T00617                                 

Definition
(GenBank) hypothetical protein
Organism
amr  Acaryochloris marina
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABW26090
UniProt: B0C1S4
Position
1016032..1016484
Genome map
AA seq 150 aa AA seqDB search
MVECSSLGEKFGGPQALPPRRDVAYFVDEETAQEDARMFADYKNTINSDDPSLVKRYSEL
LHKQANLHRHVPFAWDHDMFKGLIRWAVLEWGKPGREDMAYFLDPKIAQEDAKAFSILRD
RRLYSSEEQIRKLYATTHKVAERTIHPVHS
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
gtggtagagtgctctagccttggggaaaaatttggtggcccccaagccttgcctcccaga
agggatgtggcttattttgtggacgaagaaacggcccaagaagatgctcggatgtttgcg
gactacaaaaatacgatcaactctgatgatccgtctctcgtcaagcgatattcagagtta
ttgcacaaacaagcgaatcttcaccgtcatgtcccatttgcctgggatcatgacatgttt
aaggggttgattcgctgggcagttctcgaatggggaaaaccgggtagagaagatatggcc
tattttcttgatccaaaaattgcccaggaagatgctaaggcattcagcattttacgagat
agaagactttactcttctgaagaacaaattcgtaaactgtatgcaacgactcataaagtt
gccgaacgtacaattcatcccgtccatagctaa

DBGET integrated database retrieval system