KEGG   Acaryochloris marina: AM1_1054Help
Entry
AM1_1054          CDS       T00617                                 

Definition
(GenBank) hypothetical protein
Organism
amr  Acaryochloris marina
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_holin_3_3
Motif
Other DBs
NCBI-ProteinID: ABW26094
UniProt: B0C1S8
Position
1020376..1020636
Genome map
AA seq 86 aa AA seqDB search
MKHLLIPLFILGCISLLTGYFRFIVDDKGNIPINRFRLTGCIGDVLVGMVLGTSDLCARQ
LSDKAKSALLVYGGIALFFLGFQLGT
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacatctactgattcccctatttattttggggtgcattagcctactgacaggctac
ttccggtttattgtcgatgacaaaggcaatattcctatcaatcgttttcgactgacgggc
tgtatcggtgatgtcctagtgggaatggttctgggcaccagcgatttatgcgctcgccaa
ctatcggacaaagcgaaatctgctttgttggtctatggagggattgctcttttttttcta
ggatttcaactgggaacttaa

DBGET integrated database retrieval system