KEGG   Acaryochloris marina: AM1_1539Help
Entry
AM1_1539          CDS       T00617                                 

Gene name
chlB
Definition
(GenBank) light-independent protochlorophyllide reductase, B subunit
  KO
K04039  light-independent protochlorophyllide reductase subunit B [EC:1.3.7.7]
Organism
amr  Acaryochloris marina
Pathway
amr00860  Porphyrin and chlorophyll metabolism
amr01100  Metabolic pathways
amr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AM1_1539 (chlB)
Enzymes [BR:amr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     AM1_1539 (chlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro PCP_red
Motif
Other DBs
NCBI-ProteinID: ABW26564
UniProt: B0C929
Position
complement(1521006..1522532)
Genome map
AA seq 508 aa AA seqDB search
MKLAYWMYAGPAHIGTLRVASSFKNVHGIMHAPLGDDYFNVMRSMLERERNFTPVTASVV
DRHVLARGSQEKVVDNITRKDEEENPDLIVLTPTCTSSILQEDLENFVERASLSTQGDVL
LADVNHYRVNELQAADRTLDQIVQFYIQKARKNGDLLEEKTAKPSVNIIGVSTLGFHNQH
DCTELKRLMADLGIEVNEVIPEGASVHNLKRLPQAWFNLIPYREIGHMSAHYLEKEFGMP
FVDITPMGVVETARCIRKIQEVLNAQGADVNYEEYIENQTLHVSQAAWFSRSIDCQNLTG
KKAVVYGDNTHAAAMTKILAREMGIHVVWAGTYCKYDQEWFRKEVSEYCDEVLINEDHGA
IGDAIARVEPSAIFGTQMERHVGKRLNIPCGVIAAPIHIQDFPIGYKPFLGYEGTNQVAD
LVYNSFTLGMEDHLLEIFGGHDTKEVITKGISADSDLGWSADGQAELNKIPGFVRGKVKR
NTEKFARERNITEITAEVLYAAKEAVGA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagcctactggatgtacgctggtccagcgcatattggcacgttgagagtggcc
agttctttcaaaaatgttcacggcattatgcatgctcccttgggggatgactacttcaac
gtcatgcgctccatgctagaacgagagcggaatttcactcccgtgacggccagcgttgtc
gatcgtcatgtattggctcgtggatcccaagagaaggtagtcgataacattactcgcaag
gatgaagaggaaaatccagatttgattgtcctcacccctacctgtacctccagtattttg
caagaagacctagagaactttgtagagcgggcctcccttagcactcaaggggatgtccta
ctggctgatgtgaatcactatcgggtcaacgagctacaggctgcagaccgtacccttgac
caaattgttcagttttatatccaaaaagcccgtaagaatggcgatttactggaagaaaaa
accgctaagccttccgttaatatcattggggtttcaaccctagggttccataaccagcat
gactgcaccgaactaaagcggctcatggctgacttaggcattgaagtcaacgaagtcatt
cctgaaggggcttcagtccataacctcaagcgtctccctcaagcctggtttaacctgatt
ccctatcgtgagattggccatatgtccgctcactatctggagaaagagtttggcatgcct
ttcgtcgatatcacacccatgggtgtggtggaaacagctcgttgcattcgcaaaattcaa
gaagtactgaatgcgcaaggagcagatgttaattacgaagagtacatcgaaaaccagaca
ttacatgtttcccaggcggcttggttctctcgctccatcgactgccaaaacctcaccggt
aaaaaagcagttgtctatggcgataacacccatgctgcagccatgaccaaaatcttggca
cgggaaatgggcattcatgtggtttgggccggtacatactgcaaatatgatcaagaatgg
ttccgcaaagaagtcagcgagtattgtgacgaagtactgatcaatgaagatcatggtgct
atcggcgatgccatcgcccgagtcgaaccctctgctatcttcggcacacaaatggagcgt
cacgtgggtaagcggctcaatattccttgtggggtgattgcagctcctatccatatccaa
gatttccccatcggctacaagcctttcctgggctatgaagggaccaatcaggttgctgat
ttggtttacaactcctttaccctcggcatggaagaccacttgttagaaatcttcggtggc
catgacaccaaagaagtgatcacgaagggaatctcagctgattctgatttgggttggagt
gctgatgggcaagccgaactcaacaaaattcctggttttgttcgcggcaaagtgaagcgg
aataccgagaaatttgctcgtgaacggaatattactgagataactgctgaagttctgtat
gcagccaaagaagcggttggtgcttaa

DBGET integrated database retrieval system