KEGG   Acaryochloris marina: AM1_1697Help
Entry
AM1_1697          CDS       T00617                                 

Definition
(GenBank) CDP-alcohol phosphatidyltransferase, putative
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
amr  Acaryochloris marina
Pathway
amr00564  Glycerophospholipid metabolism
amr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AM1_1697
Enzymes [BR:amr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     AM1_1697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf vMSA CRPA
Motif
Other DBs
NCBI-ProteinID: ABW26718
UniProt: B0CB79
Position
1677424..1678059
Genome map
AA seq 211 aa AA seqDB search
MPNESTPVQDSIESPEETTITVPLSLLDRIVQFFTIKLAKSLAHFTWITPNRVTWVSAGI
GGPLTGWLIIQEQFWLATALVVVSGLMDGLDGDIARERNLTSIEGGILDSVLDRYVDFFL
IAALILVNPTEHLLVGLFALMGTTMVPYIRARSEVAGKSSIASIGSRATRIVLIILGLLT
QQLFILLIALAVISNIAAVHRFWFALIPAED
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacgagtccacacctgttcaggattctattgaaagcccagaagagacaacgatt
acggtgcctctgtctttgctggaccggattgtgcagtttttcaccattaaactggccaag
tctcttgctcacttcacctggattacccccaatcgagtcacctgggtgtctgcagggatt
ggcggtcctctgacgggatggctgattattcaggagcagttctggctggcaacggcatta
gtggtggtcagtggcttgatggacggattggatggggacatcgcccgagaacgcaatctg
acttcgattgaagggggtattttagacagcgttttagatcgttatgtcgatttcttcttg
attgcagcacttattttggtcaaccccactgaacatttactcgtgggcctatttgcccta
atgggaaccacaatggtgccttacattcgggctagaagtgaggtcgccggtaaaagttcg
attgccagtattggcagccgagcgacccgcatcgtcttgattattttgggattgctcacc
caacagctgtttattttgctgattgcattagccgttatttccaatattgctgcagttcac
cgattttggtttgcgctgattcctgccgaagattag

DBGET integrated database retrieval system