KEGG   Acaryochloris marina: AM1_1752Help
Entry
AM1_1752          CDS       T00617                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
amr  Acaryochloris marina
Pathway
amr00900  Terpenoid backbone biosynthesis
amr01100  Metabolic pathways
amr01110  Biosynthesis of secondary metabolites
amr01130  Biosynthesis of antibiotics
Module
amr_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AM1_1752 (ispE)
Enzymes [BR:amr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     AM1_1752 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABW26773
UniProt: B0CC88
Position
complement(1740097..1741029)
Genome map
AA seq 310 aa AA seqDB search
MHAYTLKAPAKINLLLEIIGDRPDGFHELVMVMQSVNLADIVELQPLSGDRIELFCNHPQ
VPCDQSNLAHRAARLMQEQFPGKGGVAITIDKKIPIGAGLAGGSADAAAVLVGLDLMWGL
GLTQAELHTYAAKLGSDIPFCVSGGTALALGRGEELTPLPDLDQLYAVLAKYRSLSVATP
WAYKTYRQQFSESYARDPEALEKRRREGHSVELLAAISHRDSQKVPQYLYNDLEKVVLPE
HPQVQEIRDLFQSFGALGTMMSGSGPTVFGLADSRSKAELMATQLQTALPDPDLEILVTK
FCSSGIQLLS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcttataccctgaaggctcccgccaagatcaatctattgttggaaattattggt
gatcgaccggatgggttccatgaattggtgatggtgatgcagagcgttaacttggcggat
atcgttgagttacagcccctgagtggcgatcggattgagctgttttgcaatcatcctcaa
gtgccttgcgaccagtcgaacttggcccatcgggccgcgaggctgatgcaggaacagttc
ccaggcaaaggcggtgtcgccattacgattgataaaaaaattcccattggtgcggggctg
gcgggagggtctgcagatgcggcagccgtgttagtggggttggatctgatgtgggggttg
ggattaacccaagctgaactccatacctatgcggccaagttggggtctgatattcccttt
tgtgtgtcggggggaacggccttggccttagggcgaggggaagaactgacgccacttcct
gacttggatcagctctatgcagtgttggccaagtatcgaagtttgtccgttgccacgcct
tgggcctataagacctatcggcaacaatttagtgagtcctatgctcgtgatccagaagcg
ctagaaaagcggcgacgtgaaggacattcggtggaactgttggccgcgatttcccatcgc
gattcccaaaaagtgcctcaatatctatataacgatttggagaaagtggttctgcctgaa
catcctcaggtgcaggaaattcgtgacttattccaatcttttggagccttgggaacgatg
atgtcagggtcaggaccaacggtgtttgggttagcggattcgcgttccaaggccgagtta
atggcgacccagttacaaacggctcttccagatccagatttagaaattctggtaactaaa
ttttgtagtagtggcattcaattgttgtcttag

DBGET integrated database retrieval system