KEGG   Acaryochloris marina: AM1_1783Help
Entry
AM1_1783          CDS       T00617                                 

Gene name
rbcS
Definition
(GenBank) ribulose bisphosphate carboxylase, small subunit RbcS
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
amr  Acaryochloris marina
Pathway
amr00630  Glyoxylate and dicarboxylate metabolism
amr00710  Carbon fixation in photosynthetic organisms
amr01100  Metabolic pathways
amr01110  Biosynthesis of secondary metabolites
amr01120  Microbial metabolism in diverse environments
amr01130  Biosynthesis of antibiotics
amr01200  Carbon metabolism
Module
amr_M00165  Reductive pentose phosphate cycle (Calvin cycle)
amr_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
amr_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:amr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AM1_1783 (rbcS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AM1_1783 (rbcS)
Enzymes [BR:amr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     AM1_1783 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ABW26804
UniProt: B0CCB9
Position
complement(1774474..1774821)
Genome map
AA seq 115 aa AA seqDB search
MRTLPIERRFETFSYLPPLNDEQIRRQIQYILDQGYIAGIEFNDSPEPTAYYWTMWKLPL
FKNPSVQDVLYEIDECRSEYSDKYVRVVGFDNIRQCQVMSFIVHKPGSNSGYRPY
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgagaactttacccatagaaagacgtttcgagaccttttcctacttgcctcccctgaat
gacgagcagattcgtcgtcaaattcagtacattttggatcaaggctatattgcagggatc
gagtttaacgattctcctgagccgaccgcatactactggaccatgtggaagttgcctcta
ttcaaaaatccttctgttcaggatgttttgtatgagattgatgagtgccgctctgagtac
tctgacaagtatgtgcgggtggttggatttgacaatatccgccagtgccaagttatgagc
tttattgttcataagccgggtagcaatagtgggtaccgcccctactaa

DBGET integrated database retrieval system