KEGG   Acaryochloris marina: AM1_2341Help
Entry
AM1_2341          CDS       T00617                                 

Gene name
sfsA
Definition
(GenBank) sugar fermentation stimulation protein
  KO
K06206  sugar fermentation stimulation protein A
Organism
amr  Acaryochloris marina
Brite
KEGG Orthology (KO) [BR:amr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99981 Carbohydrate metabolism
    AM1_2341 (sfsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SfsA SfsA_N DUF3883
Motif
Other DBs
NCBI-ProteinID: ABW27351
UniProt: B0C250
Position
2344944..2345675
Genome map
AA seq 243 aa AA seqDB search
MADWLYQYPPLLAGTLIKRYKRFLADIELDTGEVVTAHCPNTGPMTGMCAPHSRVQISQS
NNPKRKLAYTWEMIEVCDTEPTWVGVNTQIPNLVVKQLLQNRLLPTLGEYDQVKSEVRYG
REKSRIDFLLTGTAQPAYIEVKSTTWAIEKQALFPDTVTIRGQKHIRELISVLPAAQAYL
LFFINRADCTTFAPGDQADPEYGKLLREAVATGVGLLPCRFEITPEGIRYLGLATVEESS
LTR
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcggactggctatatcaatatccccctttactagcaggcacgttgatcaaacgatat
aagcgtttcctagctgatattgaactcgatacgggtgaagtcgttaccgcccattgtccg
aacaccgggcctatgaccgggatgtgtgccccccatagccgggtgcaaatttctcaaagt
aataacccgaagcgcaaattagcctatacctgggagatgattgaggtttgtgacaccgaa
cccacctgggtcggggtgaatacgcaaatcccgaatctagtggtcaaacaactccttcaa
aatcgtcttttgccgaccttaggtgagtatgatcaggtcaaatctgaggtgcgttatggt
cgagaaaaaagccgtattgattttttgctgacaggcaccgctcagcctgcctatatcgaa
gttaaaagtacgacttgggccatcgaaaaacaggctttattcccagacaccgttacgatc
cgcggccaaaaacatattcgagagttgatatcggttttacctgcagcccaagcttactta
ctcttctttattaatcgggctgattgcacaacatttgccccgggtgatcaggcagatcca
gagtacggaaaactcctcagggaagctgtggccacaggggttgggcttttaccctgccgc
tttgagattacccccgaaggcattcgctatttagggttagcaacggtcgaagaatcgtct
ttaacaagatga

DBGET integrated database retrieval system