KEGG   Acaryochloris marina: AM1_2440Help
Entry
AM1_2440          CDS       T00617                                 

Gene name
dnaK
Definition
(GenBank) chaperone protein DnaK
  KO
K04043  molecular chaperone DnaK
Organism
amr  Acaryochloris marina
Pathway
amr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:amr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    AM1_2440 (dnaK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:amr03019]
    AM1_2440 (dnaK)
   03110 Chaperones and folding catalysts [BR:amr03110]
    AM1_2440 (dnaK)
   03029 Mitochondrial biogenesis [BR:amr03029]
    AM1_2440 (dnaK)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amr04147]
    AM1_2440 (dnaK)
Messenger RNA biogenesis [BR:amr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     AM1_2440 (dnaK)
Chaperones and folding catalysts [BR:amr03110]
 Heat shock proteins
  HSP70 / DNAK
   AM1_2440 (dnaK)
Mitochondrial biogenesis [BR:amr03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    AM1_2440 (dnaK)
  Matrix
   MMC/PAM proteins
    AM1_2440 (dnaK)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    AM1_2440 (dnaK)
Exosome [BR:amr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AM1_2440 (dnaK)
  Exosomal proteins of breast cancer cells
   AM1_2440 (dnaK)
  Exosomal proteins of colorectal cancer cells
   AM1_2440 (dnaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FtsA StbA FGGY_C GARP Hydantoinase_A
Motif
Other DBs
NCBI-ProteinID: ABW27448
UniProt: B0C457
Position
2445301..2447208
Genome map
AA seq 635 aa AA seqDB search
MAKVVGIDLGTTNSCVAVMEGGKPTVIANAEGFRTTPSVVAYAKNGDRLVGQIAKRQSVM
NPENTFYSVKRFIGRRQDEVTHETTEVSYQVLTEGGSIKVDCPAAGKKFAPEEISAQVLR
KLVDDASKYLGEKVTQAVITVPAYFNDSQRQATKDAGKIAGVEVLRIINEPTAASLAYGL
DKKSNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKQIVDYLAAEFQK
AEGIDLRKDKQALQRLTEAAEKAKIELSNVTQADVNLPFITATQDGPKHLDTTLTRAKFE
ELCSDLIDRCRIPVENAVRDAKIDKSALDEVVMVGGSTRIPAILEVVKKVLGKEPNQSVN
PDEVVAVGAAIQGGVLAGEVKDILLLDVTPLSLGVETLGGVMTKLIPRNTTIPTKKSEVF
STAVDGQTNVEIHVLQGEREMSTDNKSLGTFRLDGIPPAPRGVPQIEVTFDIDANGILNV
TAKEKGTGKEQSISITGASTLSDAEVDKMVQDAEQNASVDKERREKIETKNQADTLVYQS
EKQLSELGDKVSGEDKEKAEGLIKDLKEAIASENHEQMQSLTTELQQTLYSISTQLYQQG
DAAAAGAPEGATPDEPSDTAGGDDDVIDADFTETN
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagttgttggaatagatttaggaaccactaactcttgcgtagcagtgatggaa
gggggcaaacccacggtcattgccaatgcagaaggattccggacaaccccctccgttgtc
gcttatgccaaaaatggtgatcgcttggtcggtcaaattgccaagcgccaatcggtcatg
aaccctgagaatacgttctactcagtgaagcgattcattggccgccgtcaagacgaagtc
acccatgaaacgactgaagtctcctatcaagtcctcactgaagggggcagcattaaagtg
gactgccctgcagcaggcaaaaagtttgcccctgaagagatttcagctcaggtactccgc
aaattagtcgatgatgccagtaaatatctcggcgaaaaagtcactcaggcggtaattacc
gttcccgcctatttcaacgattcccaacgccaagccacaaaggatgccggcaagattgcc
ggtgtggaagtcctgcggattatcaacgagcccaccgctgcttcgctcgcctacggttta
gataaaaaaagcaacgaaaccattttggtatttgacttggggggaggaaccttcgacgtc
tccgtacttgaagtgggtgacggtgtgtttgaagtactctccacttcgggtgatacccac
ttgggcggggatgacttcgacaagcagattgtggattacttggcagccgagttccagaaa
gccgaagggattgatctacgcaaagacaagcaagccctacagcgtctgactgaagcagca
gaaaaagccaaaattgagctttccaatgtcacccaagcggatgtcaaccttccctttatc
acagcgactcaagatggtcctaagcatttagacaccacccttactcgcgctaagtttgaa
gagctctgttctgatttgatcgatcgctgtcggattcccgttgagaatgccgtccgtgac
gccaaaatcgataagagcgctcttgatgaagtggtgatggttgggggttccacccgcatt
cccgcgattttagaagtcgttaagaaagtcctcggtaaagaacccaaccaatccgttaac
cctgatgaagtggttgccgtcggtgctgccattcaagggggtgtgctggccggtgaagtt
aaagatattctcttactagacgtcacaccgctatccttgggagttgaaacccttggtggt
gtgatgaccaagctgattcccagaaacaccacgattcccaccaagaaatcagaagtgttc
tcaacggcggtggatggccaaaccaatgtggagattcatgtactccagggtgagcgggaa
atgtctacagacaacaagagtctgggaaccttccgcttagacggcattcctcccgcaccg
cgaggcgtgcctcaaattgaagtcacctttgatattgatgccaacggtattctcaatgtc
actgctaaagaaaaaggcactggcaaagaacaatccattagcattacgggggcttccacc
ctgtccgatgctgaagtcgacaagatggttcaagatgcagagcaaaatgcctctgtagac
aaagaacgtcgcgagaagatcgagaccaagaaccaggccgatacgctggtgtaccaatcc
gagaagcagttgtctgaattaggcgataaggtttccggtgaggataaagagaaggctgaa
ggtctgatcaaagatctgaaagaagctatcgccagtgaaaaccatgagcaaatgcagtct
ctaaccactgagttgcagcaaaccctatacagcatcagcacacagctatatcagcaaggt
gatgccgctgctgcaggggcacccgaaggggctactccagatgagcccagtgataccgct
ggtggcgacgatgatgtcatcgatgctgatttcactgaaacgaactag

DBGET integrated database retrieval system