KEGG   Acaryochloris marina: AM1_2913Help
Entry
AM1_2913          CDS       T00617                                 

Definition
(GenBank) ROK family sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
amr  Acaryochloris marina
Pathway
amr00010  Glycolysis / Gluconeogenesis
amr00052  Galactose metabolism
amr00500  Starch and sucrose metabolism
amr00520  Amino sugar and nucleotide sugar metabolism
amr00521  Streptomycin biosynthesis
amr01100  Metabolic pathways
amr01110  Biosynthesis of secondary metabolites
amr01120  Microbial metabolism in diverse environments
amr01130  Biosynthesis of antibiotics
amr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AM1_2913
   00052 Galactose metabolism
    AM1_2913
   00500 Starch and sucrose metabolism
    AM1_2913
   00520 Amino sugar and nucleotide sugar metabolism
    AM1_2913
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AM1_2913
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AM1_2913
Enzymes [BR:amr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AM1_2913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ABW27913
UniProt: B0CBC8
Position
complement(2949382..2950266)
Genome map
AA seq 294 aa AA seqDB search
MTENLVLGIDLGGTAIKLGCCSPQGTCVRSITVPTPQPSTPEPVVDAISTAVHALDPDKT
LPVIGIGMPGPADNTGRIARVSINLDDWLDVPLAEWIEDKTGRPTTIANDANCAGLGEAL
YGAGQSFQNLIMLTLGTGVGGAIIMNGELYTGRDGAAGELGLITLWPDGPPCNSGNNGSL
EQFASVRAIRRDHQCEPHELAVREDESAIAFWQDYGRNLGAGLASLIYVLTPEAVILGGG
IAASTELFLPWVQAEIERRVMPTSRENLVILPAALGNQAGMIGAAQLARQRFGY
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaacctggtactagggattgatttaggagggacagcgattaagctgggttgc
tgtagccctcaaggtacttgtgtgcgctcgattacggtgccgacaccacaaccctctacg
cctgaacccgtggtggatgcgatctcaacggcagttcacgctttagatcccgataaaacg
cttccagtaattggtattggcatgcccggaccggctgataatacgggccgtattgctagg
gtctccatcaacttggatgattggttagatgtacccttagcagagtggatagaagataaa
acgggacgacccactaccattgccaatgatgccaattgtgcaggactcggcgaagctctc
tatggagccggacagtcttttcagaacttgattatgctcaccttaggtacgggagtgggc
ggtgccatcattatgaatggcgagctgtataccgggcgagatggggcggcgggggaatta
ggactgattaccctttggcccgatggtcccccctgcaatagcggtaataatggttctcta
gagcaatttgcctcggtacgtgccattcgccgagaccatcagtgtgagccccatgagtta
gcggtgcgagaagacgaaagtgcgatcgcattttggcaagattatggtcggaacttaggt
gcaggattagccagcctgatctatgtactgacgcctgaagcagtgattttagggggtgga
attgcagcgagtactgagttatttctaccctgggtgcaagcagaaatcgagcgtcgggtg
atgccaacgtctcgggaaaatttagtgattctgcctgctgctttgggcaaccaggcaggg
atgattggagcggctcaattagctcgacagcggttcggatactaa

DBGET integrated database retrieval system