KEGG   Acaryochloris marina: AM1_3571Help
Entry
AM1_3571          CDS       T00617                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
amr  Acaryochloris marina
Pathway
amr00010  Glycolysis / Gluconeogenesis
amr00020  Citrate cycle (TCA cycle)
amr00620  Pyruvate metabolism
amr01100  Metabolic pathways
amr01110  Biosynthesis of secondary metabolites
amr01120  Microbial metabolism in diverse environments
amr01130  Biosynthesis of antibiotics
amr01200  Carbon metabolism
Module
amr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AM1_3571
   00020 Citrate cycle (TCA cycle)
    AM1_3571
   00620 Pyruvate metabolism
    AM1_3571
Enzymes [BR:amr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AM1_3571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding PASTA
Motif
Other DBs
NCBI-ProteinID: ABW28561
UniProt: B0C2A9
Position
3620224..3621564
Genome map
AA seq 446 aa AA seqDB search
MIHEVFMPALSSTMEEGKIVSWSKEPGDKVEKGETVLVVESDKADMDVESFHEGYLAAIA
VPAGGVAKVGAAIGYVAETEAEIAEAQKKASAAESAAPAPAAPAPAPAAPAPAAVAPAPP
AAAPAPVATIPVAPAATLNGGSAPAAPSNGRVVVSPRARKLAKQFKVDLNTLTGSGPHGR
IVAADIEAASGQTSTTATAPAASSAAPQPSLPASAPLPAGAAAGEVVPFNTLQQAVVNNM
VASLAVPTFHVEYSIVTDALDQLYKQVKTKGVTMTALLAKAVAVTLRQHPLVNASCAPQG
IQYSSAINIAVAVAMPGGGLITPVLQQADQMDLYSLSRTWRDLVARARSKQLQPDEYSTG
TFTLSNLGMFGVNSFDAILPPGQGSILAIGGSKPQVVADDQGMMGVKRLMNVNITCDHRV
IYGADAAAFLKDLAELIETNPQSLTL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgattcatgaagtgtttatgcctgccctcagctccacgatggaggagggaaaaattgtc
tcttggtctaaggagccaggtgacaaggtcgaaaagggtgaaacggttctggtggttgaa
tccgacaaggcagatatggatgtggagtccttccatgagggatatctagcagccatcgcg
gtgcctgcgggtggggtggccaaggtcggtgcggccattggctatgttgccgaaacggaa
gctgaaattgctgaagcacaaaagaaagcatctgccgctgagtctgcggcccctgcacct
gcagctccggcccctgcacctgcagctccagcccctgctgcagtagctccggctcctccg
gctgcggccccggcccctgttgctactattccagtagccccagcagctaccttaaatgga
ggcagtgcaccggctgctccatctaacggtcgagtggtggtttcacctcgggcgcggaag
cttgctaagcaattcaaagtcgatctcaataccctaacgggcagtggtccccatggtcga
atcgtggctgcagatatagaagcagcctctggccaaacgtcgaccactgctacggctcca
gccgccagcagtgctgcgcctcagccatccctacctgcctccgctcccttacccgctgga
gcagcagccggtgaagtagttcccttcaataccttgcagcaggctgtggtgaacaacatg
gtggctagtctagctgtgcccaccttccatgtggaatattccattgttacagatgccctg
gaccagctgtataagcaagtcaagaccaaaggtgtcactatgacggccctcttggccaaa
gctgtggcggttaccctgcgccagcatcccctggtcaatgccagctgtgccccacaagga
atccagtacagcagcgccatcaatattgctgtggcggttgccatgcctgggggcggtttg
attacgccagttctgcaacaggcggatcagatggatttatattccctctctcgcacttgg
agagatttagttgctcgcgcccgtagcaaacagctgcagccggatgaatacagtaccggc
acctttaccctttccaatctgggaatgtttggggtcaacagctttgatgccattctgccc
ccagggcaagggtccattctggcgattggtgggtctaagccccaagtcgtggcggatgat
cagggcatgatgggggtgaagcgactgatgaatgtcaacattacctgcgatcaccgggtg
atctatggtgccgatgccgctgcctttttgaaggatttagcggagttgattgaaaccaat
ccccaatccttgaccctgtaa

DBGET integrated database retrieval system