KEGG   Acaryochloris marina: AM1_3606Help
Entry
AM1_3606          CDS       T00617                                 

Definition
(GenBank) conserved hypothetical protein
Organism
amr  Acaryochloris marina
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABW28596
UniProt: B0C397
Position
complement(3660837..3661148)
Genome map
AA seq 103 aa AA seqDB search
MSNHPSTQASDSSISPEITIATARKLVEQLTITSGDWHRLKTNRRARALEQAATAIVFLL
NDQSEEGLLRLQQAVGWLDRSISAPPCPTHGHGSQSTSKAPPN
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaccatccatctactcaggcctctgactcatccatctcaccagagatcaccatc
gccacagcccgtaaactcgtagaacaattaactattacgtctggagactggcaccgactt
aaaaccaatcgtcgagctagagccttagaacaggcagctacagcgattgtgtttctcctc
aatgatcagtctgaagaaggcttacttcgcttacagcaagctgtaggttggctggatcga
tccattagtgcgccgccttgtcccacccatggacatggttcacagagcacctccaaagct
ccacccaattag

DBGET integrated database retrieval system