KEGG   Acaryochloris marina: AM1_3610Help
Entry
AM1_3610          CDS       T00617                                 

Definition
(GenBank) methyltransferase, putative
Organism
amr  Acaryochloris marina
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_23 Methyltransf_25 MetW Methyltransf_12 Methyltransf_31 DREV STAR_dimer
Motif
Other DBs
NCBI-ProteinID: ABW28600
UniProt: B0C3A1
Position
complement(3665637..3666365)
Genome map
AA seq 242 aa AA seqDB search
MKNLAVSKYLLDNYKDYYQDGDNPEGDGEWRRIGAIPKVDNIIQLCRDIPHNSILEVGAG
EGSVVSRMDETGFATDLYALDISASGIERIKQRNIPSMRECQLYDGYQIPYADNHFDIVV
LSHVVEHLEYPRLLIQEASRVGKSLFVEVPLEHTLKLPKDFVFNRVGHINVYTPQTIRHL
LQSCDLIVLKQVVTAHSKDVHLHDQGKQGAINYEIKRLCLKLFPKLAVNLFTYNSALLCQ
KN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatttggccgtcagcaagtatttattagataattataaagattattaccaagat
ggagataatcctgaaggggatggagagtggcgacgaattggtgcaatcccaaaagttgat
aatatcattcaactgtgtagagatattcctcataattccatcctagaagtgggggcagga
gaaggctccgttgtgagtcgcatggatgaaactggttttgcgaccgatctgtatgcactt
gatatctcagcgtcgggtattgaacgcatcaaacaacgtaatattccctcaatgcgggaa
tgtcagctgtatgatggttatcaaataccttatgcagacaaccattttgatattgttgtt
cttagtcatgtggtagagcacttagaatatccccgcttactcattcaagaggcaagtcgc
gtcggaaaaagcttgtttgttgaagttccattagaacatactttgaaattacccaaagat
tttgtgtttaatcgcgtgggtcatatcaatgtctatacgccacaaactatccgccatctg
ttacaaagttgcgatttgatagttttaaagcaggtagttacagctcactctaaagatgtc
cacttgcatgatcaaggcaagcaaggagctataaactatgaaatcaagcgattatgctta
aagttatttcctaagttagctgttaatttatttacctataattctgcactgctttgtcag
aaaaattag

DBGET integrated database retrieval system