KEGG   Acaryochloris marina: AM1_3655Help
Entry
AM1_3655          CDS       T00617                                 

Gene name
hli
Definition
(GenBank) high light inducible protein
Organism
amr  Acaryochloris marina
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PSII
Motif
Other DBs
NCBI-ProteinID: ABW28645
UniProt: B0C3E6
Position
3711622..3712683
Genome map
AA seq 353 aa AA seqDB search
MTASVRGRRGGKVAVQTDLPTSVLSNFENEWWAGNVRMTDLSGMLLGAHLCHAALMSVVP
GAFIVQEVARYQPGVSLPDQGMIFMPHLAALGVGVGAGGEIVDTYPFFVIGVLHFFIAAV
CCAAGLFHTFRGETDLNDAPDDSYAAAFRYEWDDFESLSTIVGHHLVFISVACLIFAVNA
TYGTGMYDINTDTVHQISPNLNPITLIGYLFGFTPDGWSGAGMAAVNNMEDVIGGHFLIG
VIDLLGAAFHILYRKPTPLFTKHPVFSPANGGWSNVGMLNSELILSWSVASVGFMGISSS
LFIRYCDVAYPPVFHGVDRTGAATLQLILGLVWMLGGGLWHGLRGERLYAANK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcatctgtacgaggaagaagaggcggcaaggtagccgtccaaactgatttaccg
acatccgtattaagcaactttgagaacgaatggtgggccggcaacgttcggatgaccgac
ctatccggtatgcttctgggtgctcacctatgccatgccgccttaatgagcgtcgttcca
ggcgcgtttattgttcaagaagtagcccgttatcagccgggagtctccctgccagatcaa
gggatgatcttcatgccccacctagccgctcttggtgttggtgtaggtgctggaggtgag
atcgtcgacacctaccccttcttcgtaattggggttcttcactttttcatcgcagccgta
tgttgtgcagccggtttattccacactttccgtggtgaaactgacctgaacgatgctcct
gatgacagttatgcagccgccttccggtatgagtgggatgactttgagagcctatccacc
attgtgggtcaccacctcgtcttcatcagcgtggcctgtttgatctttgccgtcaacgcc
acctatggcaccggcatgtatgacatcaacacagacaccgtgcatcaaatcagccctaac
ttgaatccaattaccttgattggttacctctttggattcacccctgacggctggagtggt
gcaggtatggcagccgttaacaacatggaagacgtgattggcggtcacttcctcattggt
gtgattgacctattaggcgcagcattccatattctctatcgcaagcctaccccattgttt
accaagcatcccgtcttttcacctgccaacggtggctggtccaacgtcggtatgctcaat
agcgaactcatcctatcttggagtgttgcttccgtaggcttcatgggaatcagctcctcc
ctattcattcgctactgtgacgtcgcctatcctcctgtattccatggcgtagatcggaca
ggtgctgcaaccttgcagctcatcctgggtctagtctggatgttaggcggtggtctttgg
catggtcttcgtggagagagactctacgcagccaataaataa

DBGET integrated database retrieval system