KEGG   Acaryochloris marina: AM1_3674Help
Entry
AM1_3674          CDS       T00617                                 

Gene name
chlM
Definition
(GenBank) magnesium protoporphyrin O-methyltransferase
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
amr  Acaryochloris marina
Pathway
amr00860  Porphyrin and chlorophyll metabolism
amr01100  Metabolic pathways
amr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AM1_3674 (chlM)
Enzymes [BR:amr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     AM1_3674 (chlM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_12 Methyltransf_23 Methyltransf_31 Methyltransf_11 CMAS PrmA MTS Methyltransf_32 CheR TehB NodS Methyltransf_18 Ubie_methyltran Methyltransf_4 tRNA_U5-meth_tr UPF0020 Herpes_glycoH_C AdoMet_MTase DREV Peptidase_C39_2 N2227
Motif
Other DBs
NCBI-ProteinID: ABW28664
UniProt: B0C4C0
Position
complement(3729181..3729873)
Genome map
AA seq 230 aa AA seqDB search
MPTTNDKAVVQDYFNTVGFDRWRRIYGDGDVNKVQKDIRIGHQQTVDTVISWLKADGDLS
GQSFCDAGCGVGSLSIPLATMGIQVSASDISKKMVEEAQSRAQQTLGQDQNPNFSVQDLE
TLSGSFDTVICLDVLIHYPDQKVPEMINHLASLAKSRIILSFAPWTIGYMLLKKIGSFFP
GPSKTTRAYLHRDFDICDILRSQGWTIERKAMTKTSFYFSRIIEAKRPDA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccaccaacgataaagctgttgtccaagattatttcaataccgttggtttcgac
cgttggcggcggatttatggcgacggagatgtcaataaagttcaaaaagacattcgcatc
ggccatcagcaaacggtagataccgtgatctcctggctaaaagccgacggagatttatcg
ggacaatccttttgcgatgcaggctgtggcgtgggtagtttaagtatccccttggcaaca
atgggcatccaggtctcggccagcgatatttctaaaaaaatggtggaagaggcccagtct
cgagcccagcaaaccttgggccaagatcaaaatcctaacttcagcgttcaagacttagaa
accttatccgggagttttgatacggtcatttgtctggacgttttgatccattatcccgac
caaaaagtaccggaaatgatcaaccacttagcatcccttgccaaatcccggattattctg
agctttgccccctggacgattggctatatgttgttgaagaaaatcggcagcttcttcccc
ggtcccagcaaaacgacccgcgcttatctacatcgagattttgatatttgcgacattttg
cgatcccaaggatggaccattgaacgcaaagctatgactaaaaccagcttctatttctcc
cgcatcattgaagccaagcgtccagacgcatag

DBGET integrated database retrieval system