KEGG   Acaryochloris marina: AM1_3729Help
Entry
AM1_3729          CDS       T00617                                 

Gene name
terC
Definition
(GenBank) membrane protein TerC, putative
Organism
amr  Acaryochloris marina
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TerC DUF475
Motif
Other DBs
NCBI-ProteinID: ABW28719
UniProt: B0C4H6
Position
3784301..3785113
Genome map
AA seq 270 aa AA seqDB search
MLDPLFELSPQVGLDTALIIFILIALEAVLSADNAIALAALVKGLEDEELQSRALNIGLL
AAFAMRMLLIFTATWVIRFWQFELLGACYLLWLAFQYFFKEDDEHHHHGPKFASLWQAIP
VIAVTDLAFSLDSVTTAIALSDERWLVITGGIFGIITLRFMAGLFIKWLEEYIHLQDAGY
LTVVLVGFRLLLKVINDDFVPPQWSMILAIALIFAWGFSKKRNPDDPEPQNLVEHDSERP
ELANEVSDFIQEVRDLSQPDPKPQAVNEQI
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgctagacccgttgtttgaactctctccccaggtcggtctcgacaccgcactcattatt
tttattttgattgctttagaggctgtactgtctgctgataatgcgatcgcattagcggca
ttggtcaaaggactggaggatgaagagcttcagagtcgtgccttaaatattggcttgttg
gccgctttcgctatgcggatgctgctaatttttaccgcaacctgggtgattcgattctgg
cagtttgagctgttaggggcttgctacttactatggctcgcctttcagtatttcttcaaa
gaagatgatgaacaccatcatcatggccctaagtttgcctcgctctggcaagccattcca
gtgattgccgtgacggatttggcgttttcattagatagcgtgaccactgccattgcccta
tcggatgagcgttggctcgttattaccggcggcatttttgggattatcacgcttcgattt
atggccgggctatttatcaagtggctagaagagtatatccatctgcaggatgcaggctat
ttgacggtagtgttggtgggattccggctcctgctcaaggtcatcaatgatgattttgtg
ccgcctcaatggtcaatgattttggcgattgccctgatctttgcctggggattttccaaa
aaacgcaatcccgacgatccagaacctcaaaaccttgtagagcatgattctgagcgacct
gaattagccaacgaagtgagtgactttattcaggaagttcgagatctatcccaacctgat
ccgaagcctcaagctgtgaatgagcagatttag

DBGET integrated database retrieval system