KEGG   Acaryochloris marina: AM1_3735Help
Entry
AM1_3735          CDS       T00617                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09966  uncharacterized protein
Organism
amr  Acaryochloris marina
Brite
KEGG Orthology (KO) [BR:amr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    AM1_3735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2237
Motif
Other DBs
NCBI-ProteinID: ABW28725
UniProt: B0C4I2
Position
complement(3788674..3789066)
Genome map
AA seq 130 aa AA seqDB search
MTKAMKTEATNVLGGPLQICCTSPMTGFYRDGKCNTGAGDMGAHIVCAQVTAEFLAYTQA
QGNDLSSPAPIYGFPGLKPGDCWCLCASRWQQALEAGVAPPVKLAATHAMALEHVSLEDL
KQYAVDAKAD
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagccatgaagacagaagccaccaatgtactgggaggccccttacagatttgc
tgcacttcgcccatgacgggattttatcgggatggaaagtgtaatactggcgccggagat
atgggggctcatattgtctgcgcccaagttaccgctgagtttttggcctatacccaagct
caaggcaatgatttaagtagtccagctcccatttatgggttccctggtctgaagcccggt
gactgctggtgtttatgtgcctctcgctggcaacaagctttagaagcaggtgtcgcgccc
cccgtgaagttagccgccacccatgccatggccctggagcatgtctcccttgaggatctc
aaacaatatgcggtcgatgctaaagctgactaa

DBGET integrated database retrieval system