KEGG   Acaryochloris marina: AM1_3760Help
Entry
AM1_3760          CDS       T00617                                 

Definition
(GenBank) hypothetical protein
Organism
amr  Acaryochloris marina
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_23 FapA
Motif
Other DBs
NCBI-ProteinID: ABW28750
UniProt: B0C5M9
Position
3820026..3820994
Genome map
AA seq 322 aa AA seqDB search
MITHQTLCKKHHSLKRNCLKFLSVSSVLLILISGCSSDSSKSKSKAQTEDPAAASSPAPL
NSTPTKLKLTVASPESLRVKQGDLIVKGQILVDRTAARQNIMARRQKVQQEVALLTATEQ
IPTAPTNTNAAEVQVQQARERVRLADAAIQDYLAKSPYTDLARQTLPLPTEEKQLAQLQF
AKTSAQAQLEQAIAQRKSLQASQQARQQGQAVASSKKIQLLNELKTIEAQLQSFQDILSP
HDAIVQKVDWQKKGKNGTTVELALAVHSLSDPIPSLSNGTNNPLLSVPSPAPASGQPFPS
LPAPLAPTPQPPGQVPTAAQQP
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattactcatcaaaccctctgtaagaaacatcattcgttgaagcgcaactgcttaaaa
ttcttgagtgtgagcagtgttcttcttatccttatcagtggatgcagttcggatagctct
aaatccaaatcgaaggcccaaacagaggatccggcagcagcaagttctccagcgccgctc
aactcaacgccgacaaaattaaagttaacggtcgcttctcctgagtctttgcgtgttaaa
cagggggatttgattgttaaggggcaaattttggtcgatcggactgcagcccgccaaaat
attatggctcgtcgtcagaaggtgcaacaagaagtggcgcttttaacggcgactgaacag
attccgacggctccaaccaataccaatgccgcagaggttcaggtacagcaagcccgagaa
cgggttcgtttagcggatgctgcgattcaagattatctggctaaatctccttacactgat
ttggcccgccaaaccctgcctctaccgacagaggagaaacagttagcacagttgcagttc
gccaaaacatcagcccaagcccagttagagcaggctattgcccaacgtaagtcgttgcag
gcatctcaacaagctcgacaacaggggcaggcggttgcgtctagtaaaaagattcaactt
ctcaatgagctgaaaaccattgaggcccaactccagtcgtttcaggatattctgtctccc
catgatgcgattgtgcaaaaggtcgactggcaaaaaaagggaaagaacgggacaacggtc
gaacttgccctagccgttcattccctgtcggatccgattccatccttgtcgaatggcacc
aataatcctctgctatcggtgccgagtcctgcccctgctagcggacaaccctttcccagt
cttcctgcacccctagcccccactccccaaccgccagggcaggttccgactgctgctcag
cagccgtga

DBGET integrated database retrieval system