KEGG   Acaryochloris marina: AM1_4360Help
Entry
AM1_4360          CDS       T00617                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
amr  Acaryochloris marina
Pathway
amr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amr01100  Metabolic pathways
amr01110  Biosynthesis of secondary metabolites
amr01130  Biosynthesis of antibiotics
amr01230  Biosynthesis of amino acids
Module
amr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AM1_4360 (trpC)
Enzymes [BR:amr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     AM1_4360 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh NanE
Motif
Other DBs
NCBI-ProteinID: ABW29339
UniProt: B0CEU2
Position
complement(4388751..4389662)
Genome map
AA seq 303 aa AA seqDB search
MQIRRRPPSVAVNVQELQYQVKTPENEPRNILEKIVWFKETEVEQMRDSVSLLDLRKQVA
NCEPPLSFLDALKHGKTQPALIAEVKKASPSKGVLRENFDPVAIAQAYEAAGASCLSVLT
DAEFFQGSFDYLQQIRAAVSLPLLCKEFVIYPYQIYLARSRGADAVLLIAAILSDQDLTY
FLKIIKSLGMTALVEVHTLPELERVMDIPGIELIGINNRDLETFTVDLEVTCQLLAQQGT
SLQDQDILVVSESGLHTSADLAQVKQAGAGAVLIGESLVKETGNASTHSETEQMQAKISA
LFS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattcgccgtcgtccccccagtgtggccgttaatgttcaagagttacaatatcag
gttaaaacccctgaaaatgaacctcgcaatatcctagaaaagattgtttggttcaaagaa
acggaagtcgagcagatgcgggactctgtctcccttctagatttacgcaagcaagttgcc
aattgtgagccccccctatccttcctggatgcgttaaagcatggcaagacccagcctgcc
ctaattgctgaagtcaaaaaagcatcgcccagcaaaggcgtgctgcgggaaaacttcgat
cctgttgccattgctcaggcctatgaagccgctggggcttcgtgtctatcggtattgaca
gatgcagaatttttccagggcagctttgattatttacaacagattcgtgccgccgtcagc
cttcccttgctttgcaaagaatttgtgatctatccctaccaaatttatctagcgcgatct
cggggagcagatgcagttttgctgattgccgccattttgagcgatcaagacctcacctat
tttctcaagattattaaatctttagggatgactgccttagttgaggtgcataccctccca
gagttagagagagtcatggatattcctggaattgagcttatcggtatcaataaccgggat
ttagagacgtttacagtcgatttagaggtcacctgccaattactggctcagcagggaacc
tctcttcaagaccaagatatcttagtggtcagtgagtcaggtttacatacctccgcagac
ctggcccaagtcaagcaggcaggggcaggtgcggtcttaattggggaatccttagtaaaa
gaaacgggcaatgcatctacccatagtgaaacagaacaaatgcaagctaaaatttctgct
cttttttcctaa

DBGET integrated database retrieval system