KEGG   Acaryochloris marina: AM1_4701Help
Entry
AM1_4701          CDS       T00617                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
amr  Acaryochloris marina
Pathway
amr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:amr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AM1_4701 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:amr03011]
    AM1_4701 (rplV)
Ribosome [BR:amr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AM1_4701 (rplV)
  Bacteria
    AM1_4701 (rplV)
  Archaea
    AM1_4701 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ABW29673
UniProt: B0C1D8
Position
4732050..4732412
Genome map
AA seq 120 aa AA seqDB search
MTTQLKDINGAYAKAKYIRMSPRKVRRVLDQIRGRSYREALIVLEFMPYRACEPVLKVLR
SAVANAETNRGLDPVDLVVSHAYADQGPRLKRFRPRAQGRAYQIQKPTCHITIAVSAEAS
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgcaactcaaagatatcaacggcgcatacgccaaagccaaatatatccgcatg
tctcctcggaaagtgcgccgggttctggatcaaattcggggccggagctaccgagaagcc
ctgattgttctcgaatttatgccttaccgagcctgtgagccagtcttaaaggtgttacgt
tcggcggtggccaatgccgaaaccaatcgcggattggaccctgtagatctcgtagtcagt
catgcctatgcagatcaaggtcctcgcttaaagcggtttcgccctcgtgcccaaggacgg
gcctatcaaattcaaaagccgacctgccatatcaccattgcggtgagcgctgaggctagc
taa

DBGET integrated database retrieval system