KEGG   Acaryochloris marina: AM1_5103
Entry
AM1_5103          CDS       T00617                                 

Gene name
ureD
Definition
(GenBank) urease accessory protein UreD
  KO
K03190  urease accessory protein
Organism
amr  Acaryochloris marina
Brite
KEGG Orthology (KO) [BR:amr00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    AM1_5103 (ureD)
SSDB
Motif
Pfam: UreD Phage_CI_repr
Other DBs
NCBI-ProteinID: ABW30067
UniProt: B0C790
Position
5156926..5157777
AA seq 283 aa
MQQLEKQSDLASWHGRLSLTYEKKAHQTQVQQSYHQAPLNLQRPFYPEGPVCHSVMMHTA
GGMVGGDRLSINVTLQPQTHALLTTTSAGKVYRSNGHGAQQTVQCQLDTNAILEWLPLGT
IVFDQAQFRQTLQVELGPGAIFCGWDLTRFGRSARGERFMQGDWRSHTEIWQQGAPLWID
RQWLPGQPDIWESPHGLAGQPVVGSFLWVGQGVEPNLVQTARDLWQPTTDGAEMGVTRLP
LGLVCRYRGPSSQAARQWFIQVWNLLRSTHLGRPACPPRVWPL
NT seq 852 nt   +upstreamnt  +downstreamnt
atgcagcaacttgaaaaacagtcagacttggcaagctggcatggtcgtctaagcttaacc
tacgagaaaaaagctcaccaaactcaggttcagcagagctatcatcaagcccctctcaat
ctacaacgccctttttatcctgaagggccagtttgccatagcgtcatgatgcataccgct
gggggcatggtgggcggcgatcgtctctccattaatgtgacgctgcagccccagacccat
gcgctactgacaacaacatctgcaggcaaagtctatcggtctaatggtcatggagcccaa
cagacggtccagtgccagctggatactaacgcgattctagaatggctgcccttaggaaca
atcgtctttgaccaggctcagtttcgccaaaccttacaggttgagcttggccctggggct
attttttgcggatgggatctgactcgatttggtcgcagtgcccgaggtgagcgatttatg
cagggggactggcgatctcatactgagatttggcagcagggcgcgcccctctggattgat
cgacagtggttgccggggcaaccggacatttgggaaagcccccatggcttggctggacaa
ccggttgttggcagttttctgtgggtcggacaaggggttgaacccaatctggtccagacg
gctcgtgacctttggcagcccactaccgatggggctgagatgggggtaacgcgcttaccc
cttggactggtctgccgatatcgtggtccctctagtcaagcggcccgtcaatggtttata
caggtgtggaatctgttgcgatccacccatttgggacgcccagcctgtcctccccgtgtt
tggccactctaa

DBGET integrated database retrieval system