KEGG   Acaryochloris marina: AM1_6320Help
Entry
AM1_6320          CDS       T00617                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
amr  Acaryochloris marina
Pathway
amr00030  Pentose phosphate pathway
amr00480  Glutathione metabolism
amr01100  Metabolic pathways
amr01110  Biosynthesis of secondary metabolites
amr01120  Microbial metabolism in diverse environments
amr01200  Carbon metabolism
Module
amr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
amr_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:amr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AM1_6320 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AM1_6320 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amr04147]
    AM1_6320 (zwf)
Enzymes [BR:amr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     AM1_6320 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     AM1_6320 (zwf)
Exosome [BR:amr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AM1_6320 (zwf)
  Exosomal proteins of colorectal cancer cells
   AM1_6320 (zwf)
  Exosomal proteins of bladder cancer cells
   AM1_6320 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ABW31250
UniProt: B0C7G6
Position
6389085..6390635
Genome map
AA seq 516 aa AA seqDB search
MIATALSLNPTDAIEVTGPCIIVIFGAAGDLTKRKLIPALHNLAQNKLLPDAFAILGIGR
TSTQTNAFRSQIHQDLQEFAADALESELWEWLEPRLHYLAGNFQAPETYQQLAAQLQQLD
QAFGTQGNVLFYFATAPTFFTEITQQLGAAGLVQETSDQWRRIIFEKPFGQDLASAQRLN
QEIGQVLTESQIYRIDHYLGKETVQNILVFRFGNGLFEPVWNHRYIDHIQITVAEQVGVE
SRGGYYEGSGALRDMIQNHLFQLLALTAMEPPVSFEADAVRDEKSKVLKAIEPLTAEEVL
TCAVRGQYGEGQIKDQSVSAYRLESRVSPESNTETFAALKLTIDNWRWAGVPFYLRTGKR
LPERVSEIAIQFKHVPSLLFRETSIDQLTDNFLVLRLQPNEGISLQFGAKVPGPKVRMGS
VNMDFCYANFFDATPTTGYETLLYDCMIGDATLFQRSDNVELGWQVITPILDVWSALPSR
DFPNYGAGSWGPQAATDLLTRDGRQWHSSSPQFCSA
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccactgcactcagcttaaacccgacggatgccattgaagtcaccggtccctgc
atcatcgttatttttggcgctgccggagacttaacgaagcggaaattaattccggccctc
cataatctcgcccaaaacaagcttttacccgatgcctttgcgattttagggattggccga
acctcaacccaaaccaatgcctttcgcagccaaattcaccaagatttacaggagtttgcg
gcagatgccctggaatcggagctgtgggagtggttggaacctcggcttcactacctggca
ggaaactttcaggcccctgaaacctaccagcaacttgcagcccaacttcaacagctcgat
caagcctttggaactcagggcaacgttcttttctatttcgccactgctcccaccttcttt
acggagattacccagcagcttggggcagcgggactggttcaggaaacatctgaccagtgg
cgacggattatttttgagaaaccctttggtcaggatctagcctctgcccagagattgaac
caagagattggtcaggtcctaacggaatcgcaaatttatcgcattgatcattatttaggc
aaagaaacggttcagaatatcttggtgtttcgatttggcaacggcctgtttgagccggtg
tggaaccatcgctacattgaccatatccagattactgtcgctgaacaggtgggagttgaa
agtcgcggcggctactacgaggggtcgggggcgctgcgagatatgatccaaaaccatctg
tttcagctcttagcccttacggccatggaacccccagtttctttcgaagccgatgcggtg
cgagatgagaaatctaaagtgctcaaagccattgaacccctcacggcagaggaggtcctc
acctgtgccgtccgggggcagtatggtgaagggcaaatcaaagatcagtcggtctcagcc
tatcgactcgaatcgcgggtgtctccagaatccaatacggaaacctttgcagccttaaag
ctcaccattgataactggcggtgggcgggggtgcccttttacctgcgcacgggtaaacga
ctgccggagcgggtgagtgaaattgcgattcagttcaaacacgtcccctccctgctgttt
cgggagacctctattgatcagcttacggataactttttagtcctcaggctgcagcctaac
gaaggcatcagcctccagtttggagcaaaagttcctggccccaaagtgcgcatgggcagc
gtcaatatggacttttgctatgccaatttctttgatgccacccccaccactggctatgaa
accttgctgtatgactgcatgattggcgatgccaccctgtttcagcgatccgacaatgtg
gagctgggctggcaggtcatcacgccgattttagatgtgtggagcgctctccccagccga
gatttcccgaactatggggcgggaagttggggaccgcaagctgccacagatttactcacg
cgagacggacgccaatggcacagcagcagtcctcagttttgtagtgcttag

DBGET integrated database retrieval system