KEGG   Acaryochloris marina: AM1_6422Help
Entry
AM1_6422          CDS       T00617                                 

Gene name
pyrH
Definition
(GenBank) uridylate kinase
  KO
K09903  uridylate kinase [EC:2.7.4.22]
Organism
amr  Acaryochloris marina
Pathway
amr00240  Pyrimidine metabolism
amr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AM1_6422 (pyrH)
Enzymes [BR:amr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.22  UMP kinase
     AM1_6422 (pyrH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: ABW30460
UniProt: B0CDY6
Position
5556198..5556926
Genome map
AA seq 242 aa AA seqDB search
MGNTYQRVLLKLSGEALMGTLPYGIDPTIVQGIAEEISDVASRGIQVAIVVGGGNIFRGV
KGAAAGMDRATADYIGMIATVMNAMTLQDALEQMNVPTRVQTAISMQELAEPYIRRRAMR
HLEKGRVVIFGAGSGNPFFTTDTTAALRAAEIDADIIMKATKVDGVYDSDPKINPDAKRF
QSLTYGHVLTHDLKVMDSTAIALCKDNDIPILVFDLSVSGNIRRALLGESIGTIVGGSCG
VS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggggaatacctatcaacgggtcctattaaagcttagtggcgaagccctaatgggaact
ttgccctatggtatcgaccccaccattgttcagggaattgccgaagaaatctctgatgtc
gccagtcgaggcattcaggtcgctattgtggtcggagggggcaatatctttcgcggcgtg
aaaggtgcagccgcaggcatggatcgagcaactgccgactatattggcatgattgcaacg
gtgatgaatgccatgaccctgcaagatgcccttgaacaaatgaatgtaccgactcgggta
caaaccgctatttccatgcaggaattagcagaaccctacattcgtcgtcgcgccatgcgc
catctcgagaaaggccgggtggttatttttggtgcagggtctggcaatccgttctttacg
acagacaccacggcagcgttgcgggcggctgaaatcgatgcagacatcatcatgaaagcc
accaaggtagatggggtgtacgactcagatcctaaaataaatcccgatgccaagcgattt
caaagtttaacctacggacatgtcctcacccatgatctgaaagtgatggacagcactgcg
atcgcattgtgcaaagacaacgatattcctattttggtctttgacctttccgtttctgga
aatattcgacgggccctattgggcgaatctattggcactattgtgggaggttcttgtgga
gttagctga

DBGET integrated database retrieval system