KEGG   Acaryochloris marina: AM1_A0127Help
Entry
AM1_A0127         CDS       T00617                                 

Definition
(GenBank) xenobiotic reductase B, putative
Organism
amr  Acaryochloris marina
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN Catalase_C
Motif
Other DBs
NCBI-ProteinID: ABW31636
UniProt: A8ZKD6
Position
pREB1:complement(114230..115342)
Genome map
AA seq 370 aa AA seqDB search
MTATGTSPTLLSSFNLHDLPLANRIVMAPMTRSRAGEEMLANAMMAEYYAQRASTGLIVT
EGTFISDQAIGWQHVPGIYTQEQTQAWQVVTKAVHEKGGKVFLQLWHCGRASHSSFHQDH
QLPVAPSAIKLEGDSIHTPQGKQPYENPRALSTDEIPLVVEDYRQAAINAKTAGFDGVEI
HSANGYLLDCFLQSKTNQRQDRYGGTLENRYRFLKEVVEAISQVWPTQRIGVRLSPNGIY
NDMGSQDYRETFLYVAKQLNTFDLAYLHVLDGLAFGFHELGEPMQLSEFRSVYNGTIIGN
CGYSQEDADDRISNGHADLIAFGRPFISNPDLVERFTNGWPLNPPAEQSIWYSFDREGYT
DFPVYSESQA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaacaggaacatccccgacattactcagcagtttcaatcttcatgatttgcca
ctcgccaatcgtatagtcatggctcccatgacaagatcgcgagctggggaagaaatgttg
gcgaatgcaatgatggctgaatattacgctcaacgggcatcaacaggcttgattgtcaca
gaaggaacctttatctcagaccaagccatcggttggcagcatgttcctggaatttacacc
caagagcaaacccaagcttggcaagtagtaactaaagctgttcatgaaaaagggggtaag
gtttttctacaactttggcattgtggacgagcttctcacagcagctttcatcaggatcat
cagctacctgtagccccctcagctatcaaacttgagggggactcaattcataccccacaa
ggcaagcagccctatgaaaacccacgtgctttaagtaccgatgagattccactggttgtt
gaagattatcgacaagctgctatcaatgccaaaacggctggctttgacggtgtggaaatt
cacagtgccaacggttatctgcttgattgcttcttgcaaagtaaaaccaatcaacgtcaa
gatcgttacggtggaactttggaaaaccgctatcgatttctaaaggaagttgtagaggca
atttcccaagtctggccaactcagcgcatcggtgttcggctttcaccgaatggtatctat
aacgacatggggtcacaagactatcgtgaaacattcttgtatgttgctaagcagctaaat
acctttgatctagcttatctccacgttttagacggtctggcctttggattccatgagtta
ggtgagcccatgcaattatctgaatttcggtctgtctataacggaactatcattggcaac
tgtggatatagtcaagaggatgcagacgatagaatttcgaacggtcacgctgatttaatc
gcttttggccgaccgttcatcagcaatccagatctagtggaacgtttcacaaatggctgg
cccttaaacccacctgcagagcagagtatttggtactcattcgatagggaaggatacaca
gacttcccagtctattcagaatctcaagcctaa

DBGET integrated database retrieval system