KEGG   Acaryochloris marina: AM1_A0181Help
Entry
AM1_A0181         CDS       T00617                                 

Definition
(GenBank) major facilitator family protein
Organism
amr  Acaryochloris marina
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_3
Motif
Other DBs
NCBI-ProteinID: ABW31688
UniProt: A8ZKI8
Position
pREB1:complement(163069..164331)
Genome map
AA seq 420 aa AA seqDB search
MRTFLIIWLGQFASLLGSELTNFAITLWAWEITGQATPLSLIMVFTQIPKLLVSPFAGIW
VDRYSRKHLMLLGDLAAGLSTLTLLMLFLTDQLQVWHLYLSGAINGLFGYIQGLAYSASL
TLIVAEKHYARATALGSVQMSGSYVLAPALAGALYAATGLTGVLSIDIVTFGMAITSLAL
VKIPQPSEQPTKPKTSWSSLAFGLQYLWVRPSLMALLGFWIVNSLIGSTIFAILPAMVLA
RSNNNPLIWGTLLAFFGMGGLLGGLTISISGGPKRRIHGVLIASALWKFGIIVLALAQQT
VTKIGTALVCGFCSPFPESANQTIWMSKVEPEVQGRVFATQFLLTQLSSPIGYAIAGPLA
DHFFEPAMQPSGALAGFFGPIFGTGLGAGMALQVSIFATCGMLIAVGGYSIRQLRWVEIT
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacctttctgatcatctggcttggacagtttgcatcactcttgggttcagaacta
accaactttgccatcactttatgggcctgggaaatcaccggacaagcaacccccttatct
ttgattatggtgttcactcagattcccaaacttctggtttccccctttgccgggatctgg
gtggatcgatactctcgcaaacacttgatgctgctaggtgatctagctgcaggactgtct
accctcaccctactgatgctgtttctcacggatcagcttcaggtgtggcatctctacctt
tctggggccattaacggcttattcggctacatccaaggtctagcctattcggcttctcta
actttaatcgtggccgaaaaacattatgcccgtgctactgccctgggttctgtccaaatg
tctgggagttatgttttggctccggctttagcgggtgcgctctatgctgccaccgggtta
acgggggttctcagcatcgatattgtcacctttggcatggcgatcaccagtctagccttg
gtcaaaatccctcagccatcagaacagccgactaaaccaaaaacgtcttggtcttcctta
gcctttggtctccagtatctctgggttcggcctagtctgatggctctactgggtttttgg
atcgtcaatagcctgattggcagtacgatattcgccattttgcccgcgatggttttagct
cggagcaataataacccgctaatttggggaacgcttctcgctttctttggcatgggcggt
ctgctgggcggactcaccattagtattagcggcggaccgaagcgccgcattcacggtgtt
ttgattgccagtgccctgtggaagttcggcattattgtgttggctcttgcacagcaaaca
gtgactaagattgggacagcgctagtgtgtggattctgttcgccgtttccagagagtgca
aatcaaaccatttggatgtcaaaggtggaacctgaggtgcaagggcgagtgtttgcaacg
caatttttgctgacccagttgagtagtccgatcggatatgcgatcgcaggtccgttagct
gatcatttctttgaaccagccatgcagcccagtggggcattagcagggttctttggacct
atttttggcacaggattaggtgcgggtatggcattacaggtttctatttttgctacctgc
gggatgctgattgccgtcggtggatatagtattcggcaattgagatgggtagaaatcacc
tga

DBGET integrated database retrieval system