KEGG   Acaryochloris marina: AM1_D0143Help
Entry
AM1_D0143         CDS       T00617                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
amr  Acaryochloris marina
Pathway
amr00010  Glycolysis / Gluconeogenesis
amr00030  Pentose phosphate pathway
amr00051  Fructose and mannose metabolism
amr00052  Galactose metabolism
amr00680  Methane metabolism
amr01100  Metabolic pathways
amr01110  Biosynthesis of secondary metabolites
amr01120  Microbial metabolism in diverse environments
amr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AM1_D0143 (pfkA)
   00030 Pentose phosphate pathway
    AM1_D0143 (pfkA)
   00051 Fructose and mannose metabolism
    AM1_D0143 (pfkA)
   00052 Galactose metabolism
    AM1_D0143 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    AM1_D0143 (pfkA)
Enzymes [BR:amr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AM1_D0143 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     AM1_D0143 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ABW32638
UniProt: A8ZNQ2
Position
pREB4:109573..110730
Genome map
AA seq 385 aa AA seqDB search
MHQVKRIGILTSGGDCPGLNAIIRAVIKCATHKGWEVFGIPYGTQGFINLELGHCTPEDL
RLKEHGYDVPGLLGGLDILQFLSGSILGALNKGNPSDPAISQEILQGFQRLNLDALIAIG
GDGSLDIIDDLAQKGQWRWVAIPKTIDNDVPFTEISLGFDTAVNTVTRSLYDLTFTAASH
DRIMVVQVMGRDAGHLALHSGIAGGADVILIPELTPSLNPSVIDQVCRQIAVLRQGGRRF
ALVVIAEGVRRPDGQKVASICDFLAQQIQVQSQTLCSSGNPKFCSLQEVDSRAIILGHIQ
RSGVPTAFDRLLAARFGREAVDLISQHHYNRLVVWENGEVASKPLTEVIPKIKDCHREKK
CPDPVDPQGGLVQTAKELGIYVGTS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcaccaagttaaacggatcggtatcctcaccagtggtggtgattgtcctgggcttaat
gccattattcgggcagttattaaatgtgcgactcacaaagggtgggaggtgtttggcatt
ccctatggcacccaaggctttattaatcttgaattaggacactgtactcctgaggacctg
aggttaaaagagcatggatatgatgtcccaggattgttagggggattagatattttgcaa
ttcctcagtggcagtatcttgggggcattaaacaaaggcaatccgagtgatccagcgatc
tcacaagaaattttgcagggttttcaacgattgaatcttgacgcactgattgccattggt
ggggatgggagtttggatattattgacgaccttgcccagaaagggcagtggcggtgggtg
gcaataccaaaaaccatcgataatgatgtgccctttactgaaatttcattgggttttgat
actgccgttaataccgttacaagatcactctacgatctcacattcacggcagcgagccac
gatcgaatcatggtcgttcaagtgatgggacgtgatgccggacatttggcactccattca
ggaatcgcagggggcgcagatgtaattttaattccagagctaaccccaagcttgaacccg
tccgtgattgatcaagtgtgtcgtcaaattgccgtgcttcgacaaggtggccgccgtttt
gctttagtcgtgattgctgaaggtgtgcgcagaccagatggtcaaaaagtcgcaagcatt
tgtgactttttagctcaacagattcaggttcaaagtcagacgttatgttcgtcaggtaat
cctaagttctgtagtcttcaagaagtggattctcgggcaatcattttggggcatatccag
cgaagcggggtgcctacagcctttgatcgtttattggcagctcgctttggtagggaagcc
gttgatcttatctctcaacatcattacaaccgtctcgtggtttgggagaacggcgaagtt
gcgagtaaacccttaacggaagttatccccaaaatcaaggattgtcatcgagagaaaaaa
tgtccagatccagttgatccacaagggggattggtgcagacggctaaggaattagggatt
tatgttggaacatcatga

DBGET integrated database retrieval system