KEGG   Actinoplanes missouriensis: AMIS_13880Help
Entry
AMIS_13880        CDS       T01795                                 

Definition
(GenBank) putative dihydrolipoamide S-succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00020  Citrate cycle (TCA cycle)
ams00310  Lysine degradation
ams00380  Tryptophan metabolism
ams01100  Metabolic pathways
ams01110  Biosynthesis of secondary metabolites
ams01120  Microbial metabolism in diverse environments
ams01130  Biosynthesis of antibiotics
ams01200  Carbon metabolism
Module
ams_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ams_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ams00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMIS_13880
  09105 Amino acid metabolism
   00310 Lysine degradation
    AMIS_13880
   00380 Tryptophan metabolism
    AMIS_13880
Enzymes [BR:ams01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AMIS_13880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF459
Motif
Other DBs
NCBI-ProteinID: BAL86608
UniProt: I0H0S1
Position
complement(1489031..1490866)
Genome map
AA seq 611 aa AA seqDB search
MPVSVTMPRLGESVTEGTVTRWLKQEGERVEADEPLLEVSTDKVDTEIPSPAAGVLTRIV
VGEDETAEVGSELAVIAGEGEDAGSAAPAPAQQQAAEPEPEPEPAALTTPSTEKPVEEET
PAPQTASAGSSEGTEVKLPALGESVTEGTVTRWLKQVGETVEADEPLLEVSTDKVDTEIP
SPVAGTVLEIKVGEDETAEVGAVLAVIGSADAAPAKQETPPPAPKQEAPKQEAPKQESAP
APQPRIESAPAPQIGESYATPSPAAETKQPAAPAQPAAPAQPAAPAAETVKSNGAGDAGY
VTPLVRKLAAEKGVDLSTLSGTGVGGRIRKQDVLDAAEKAAAAKAAPAPAADASAPAAAA
AKPAAKAEPSPLRGRTEKLTRIRATIARRMVESLQISAQLTTVVEVDVTKIANLRNKAKA
DFQAKHGVKLTFLPFFALATVEALQQHPVVNSSIDVEAGTVTYHGAEHLGIAVDAPKGLV
VPVIKDAGDLNLGGLAKRIADVAERTRNNKIGPDELGGGTFTLTNTGSRGALFDTPIINQ
PQVGILGLGAVVKRPVIVNDPELGEIIAPRSMVYLALSYDHRIVDGADAARFLGTLKERL
EGGHFEADLGL
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgccggtatcggtaaccatgccgcggctgggagagagtgtcaccgagggcaccgtcacc
cgctggctcaagcaggagggcgagcgggtcgaggcggacgagccgctgctcgaagtctcc
accgacaaggtcgacaccgagatcccgtcgcccgcagcgggcgtgctgacccggatcgtg
gtgggcgaggacgagaccgcggaggtcggcagcgagctggccgtcatcgccggtgagggc
gaggacgccggttccgccgcgcccgcgcccgcgcagcagcaggctgccgagccggagccg
gagccggagcccgccgcgctgaccacgccgtcgaccgagaagccggtcgaggaggagacc
ccggcgccgcagaccgcgtccgccggcagctccgagggcacggaggtcaagcttccggcg
ctcggcgagagcgtcaccgagggcaccgtcacgcgctggctcaagcaggtcggcgagacg
gtcgaggccgacgagccgctcctcgaggtctccaccgacaaggtcgacaccgagatcccg
tcgccggtcgccggcacggttctcgagatcaaggtcggcgaggacgagaccgccgaggtc
ggcgccgtgctcgcggtgatcgggtcggcggacgccgccccggccaagcaggagaccccg
ccgcccgcgcccaagcaggaggctccgaagcaggaggctcccaagcaggagtcggcgccg
gctccgcagccgcggatcgagtcggcccccgcgccgcagatcggcgagtcctacgccacc
ccgtcgccggctgccgagaccaagcagcccgccgccccggcccagcccgccgccccggcc
cagccggccgctccggccgccgagacggtcaagtcgaacggcgccggcgacgccggttac
gtgacgccgctggtccgcaagctggccgccgagaagggcgtggacctgtccacgctgtcc
ggcaccggcgtcggtggccggatccgcaagcaggacgtgctggacgcggcggagaaggct
gccgcggccaaggcggccccggcccccgcagcagatgcgtccgccccggcggcggccgct
gccaagcccgccgccaaggcggagccgagcccgctgcggggccgcaccgagaagctcacc
cgcatccgggccaccatcgcccggcgcatggtggagtcgctgcagatctcggcgcagctc
accacggtggtcgaggtggacgtcaccaagatcgccaacctgcgcaacaaggcgaaggcc
gacttccaggccaagcacggcgtgaagctcaccttcctgccgttcttcgccctggccacg
gtcgaggcgctgcagcagcacccggtggtcaactcctcgatcgacgtcgaggcgggcacg
gtcacctaccacggcgccgagcacctgggcatcgcggtggacgcgccgaagggcctggtc
gtcccggtcatcaaggacgccggcgacctgaacctgggtggcctcgccaagcgcatcgcg
gacgtcgcggagcggacccggaacaacaagatcggaccggacgagctgggcggcggcacg
ttcacgctgaccaacaccggcagccggggcgcgctcttcgacaccccgatcatcaaccag
ccgcaggtcggcatcctcggtctcggcgcggtcgtcaagcgcccggtgatcgtgaacgac
ccggagctgggcgagatcatcgcgccgcgctcgatggtctacctggcgctcagctacgac
caccggatcgtggacggcgctgacgcggcccgcttcctgggcacgctgaaggagcggctg
gagggcggccacttcgaggccgacctcgggctgtga

DBGET integrated database retrieval system