KEGG   Actinoplanes missouriensis: AMIS_50490
Entry
AMIS_50490        CDS       T01795                                 

Definition
(GenBank) putative oxidoreductase
  KO
K14630  two-component flavin-dependent monooxygenase [EC:1.14.14.-]
Organism
ams  Actinoplanes missouriensis
Pathway
ams01057  Biosynthesis of type II polyketide products
ams01100  Metabolic pathways
ams01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ams00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    AMIS_50490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:ams01008]
    AMIS_50490
Enzymes [BR:ams01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.-  
     AMIS_50490
Polyketide biosynthesis proteins [BR:ams01008]
 Polyketide tailoring proteins
  Oxygenase
   AMIS_50490
SSDB
Motif
Pfam: Acyl-CoA_dh_2 Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N
Other DBs
NCBI-ProteinID: BAL90269
UniProt: I0HB82
Position
complement(5349958..5351103)
AA seq 381 aa
MSIQPAPATGLARAARDVAALAAGHADQGERDRRLAVPVMRALVAAGFARHFVPAGLGGA
AGTFAELTEAVTVLGAACPATAWCASVVANLARMAAYLPGEGRKEIWRDGPDTVVVGAVS
PKGRARRDGSGWRLSGAWPYVSAVDLSDWALVLGTGKGDGEDPCTLMFAVPRDRYRVERT
WSDVGMRASGSNTLVVEDVHVPGLLTFNAADLFGGQAPGLESPCHRVPLTATSGLSFSAP
ILGAAEGALAHWSGHAAERIRAAERPGPGPGRGYYEEVLARSSGEIDAARLLLERAAGVA
DRGPLVTPAEATRNQRDCALATDLLVTAVDRLFRASGTAGHSTDHPLQRLWRDVHSAAGH
VVLQFGPSAAAYAGRALDLDG
NT seq 1146 nt   +upstreamnt  +downstreamnt
ttgtcaatccagccagcaccggccactggccttgcccgcgccgcccgggatgtcgccgcc
ctcgccgccggccacgccgatcagggagaacgggaccgtcgcctcgccgtaccggtgatg
cgggcgctcgtggcggccggcttcgcccggcacttcgtcccggccggtctcggtggcgcc
gccggcacgttcgccgagctgaccgaggcggtgacagtgctcggcgccgcctgcccggcc
accgcctggtgcgcctccgtggtcgccaacctggcccggatggccgcctacctgcccggc
gaaggacgcaaggagatctggcgcgacggaccggacacggtcgtggtcggcgcggtgtcg
ccgaagggacgggcgcggcgggacggctccgggtggcggttgtcgggtgcctggccgtac
gtcagcgcggtcgacctctccgactgggcgctggtgctcggcaccggcaagggcgacggg
gaggatccgtgcacgctgatgttcgcggtgccccgcgaccggtaccgggtcgagcgcacc
tggtcggacgtcggcatgcgggcgagcggcagcaacaccctggtggtcgaggacgtgcac
gtgcccggcctgctgacgttcaacgccgccgacctcttcggcggccaggcaccgggactc
gaatcaccgtgccaccgggtgccgctcacggccacgagcgggctgtccttcagcgcgccg
atcctcggcgccgccgagggcgccctcgcgcactggtccggccatgcggccgagcggatc
cgggctgcggagcgtcccggaccgggacccggccgcggctactacgaggaggtcctggcg
cgcagctcgggcgagatcgacgccgcgcggctgctgctggaacgcgccgcaggggtggcc
gaccggggcccgctggtcactccggccgaggccacccgcaaccagcgcgactgtgccctc
gccacggatctgctcgtcaccgcggtggatcggttgttccgggcgtccggcaccgcgggg
cacagcacggaccacccgctgcaacggctctggcgcgacgtgcactcggccgccgggcac
gtcgtcctgcagttcgggcccagcgcggcggcgtacgccggccgggctctcgacctggac
gggtga

DBGET integrated database retrieval system