KEGG   Actinoplanes missouriensis: AMIS_54730Help
Entry
AMIS_54730        CDS       T01795                                 

Definition
(GenBank) putative glycosyl hydrolase
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00500  Starch and sucrose metabolism
ams01100  Metabolic pathways
ams02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ams00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMIS_54730
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AMIS_54730
Enzymes [BR:ams01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     AMIS_54730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6 CBM_2 DUF3446
Motif
Other DBs
NCBI-ProteinID: BAL90693
UniProt: I0HCF6
Position
complement(5825015..5826781)
Genome map
AA seq 588 aa AA seqDB search
MRPIPTRARALTAAAAVSIVAGAGAVAVAGSASAAAGCRVDYSVNQWNSGFTANVTVTNL
GDPISGGWNLKWAYAGNQTVTQGWSATITQSGQNVTATNPTWAASLATNGTANFGFNANY
SGTNTAPASFALNGTVCTGNVPTSPSSSPSSSPSSSPSTSPSTSQSPQQPGTKADNPYAG
AKGYVNPEWKAKAESVTGGSRVSNNPTAVWIDRIAAINGTTGSSSNGSMGVRDHLDAALA
QGAGYIQFVVYNLPGRDCAALASNGELGPNDLPKYKTDYIDPIAAIQGDPKYASLRIINI
VEIDSLPNLVTNTSGQAGGTAMCDTMKANGGYVQGIGYALQKLGALGNVYNYVDAAHHGW
IGWDSNFGPSADIMLEAAKASGNVKNVHGFITNTANYSALREPFVQPTTTVGGQSVRQSK
WVDWNQYTDELSFAQAFRNKLVSIGFDSGIGMLIDTSRNGWGGSARPTAASTSTDVNTFV
NQSRVDRRIHAGNWCNQAGAGLGERPTAAPASGIDAYVWVKPPGESDGSSTLIPNDEGKG
FDRMCDPTYTGNARNGNSMSGALAGAPISGAWFPAQFAELMANAYPAL
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgagacccatccccacccgtgcccgggctctcacggcggccgctgccgtgagcatcgtg
gccggcgccggtgccgtcgcagtggccggtagcgccagtgcggcggccggttgtcgcgtc
gattattcggtgaaccagtggaactccgggttcaccgccaacgtcaccgtcaccaacctg
ggcgacccgatcagcggcggctggaacctgaagtgggcctacgccggcaaccagacggtc
acccagggctggagcgcgacgatcacccagtccgggcagaacgtcacggccaccaacccg
acgtgggccgcgtcgctcgccacgaacggcaccgccaacttcggcttcaacgccaactac
tcgggtacgaacaccgcgcctgcctccttcgccctgaacggcacggtctgcaccggcaac
gtgccgaccagcccgtcgagcagcccgtcgtcgtcgccgtccagctccccgtccacgtcc
ccgtcgacctcccagtccccgcagcagccgggcaccaaggccgacaacccgtacgccggg
gcgaagggctacgtgaacccggagtggaaggcgaaggccgagtcggtgaccggtggcagc
cgggtctccaacaacccgaccgccgtctggatcgaccggatcgccgccatcaacggcacc
acgggcagcagctcgaacggttccatgggcgtgcgtgaccacctggacgcggctctcgcg
cagggcgccggttacatccagttcgtcgtctacaacctgcccggccgggactgcgccgcg
ctcgcctccaacggtgagctcggcccgaacgacctgccgaagtacaagaccgactacatc
gacccgatcgcggcgatccagggcgacccgaagtacgccagcctgcggatcatcaacatc
gtcgagatcgactcgctgccgaacctggtcaccaacacctccggccaggccggcggcacc
gcgatgtgcgacacgatgaaggccaacggcggatacgtccagggcatcgggtacgcgctg
cagaagctgggcgcgctcggcaacgtctacaactacgtggacgcggcgcaccacggctgg
atcggctgggactccaacttcggcccgtccgcggacatcatgctggaggccgccaaggcg
tccggcaacgtgaagaacgtgcacggcttcatcaccaacaccgcgaactactcggcgctg
cgggagccgttcgtgcagccgaccaccacggtgggcggccagagcgtgcggcagtcgaag
tgggtggactggaaccagtacaccgatgagctctccttcgctcaggcgttccggaacaag
ctggtctcgatcggcttcgactccggcatcggcatgctgatcgacacctcccgcaacggc
tggggcggctcggcccggcccaccgcggcgagcacctcgaccgacgtcaacaccttcgtc
aaccagtcccgcgtcgaccggcggatccacgccggcaactggtgcaaccaggccggcgcc
ggcctcggtgagcgtccgaccgcggctccggcctccggtatcgacgcctacgtctgggtg
aagcccccgggcgagtcggacggctcgtccacgctgatcccgaacgacgagggcaagggc
ttcgaccggatgtgcgacccgacctacacgggcaacgcccgtaacggcaacagcatgtcg
ggtgcgctggccggcgcgccgatctccggcgcctggttcccggcgcagttcgccgagctg
atggcgaacgcctacccggctctctga

DBGET integrated database retrieval system