KEGG   Actinoplanes missouriensis: AMIS_58190Help
Entry
AMIS_58190        CDS       T01795                                 

Definition
(GenBank) putative alcohol dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00625  Chloroalkane and chloroalkene degradation
ams00680  Methane metabolism
ams01100  Metabolic pathways
ams01120  Microbial metabolism in diverse environments
ams01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ams00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    AMIS_58190
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AMIS_58190
Enzymes [BR:ams01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     AMIS_58190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_N_assoc PALP
Motif
Other DBs
NCBI-ProteinID: BAL91039
UniProt: I0HDF2
Position
complement(6229062..6230390)
Genome map
AA seq 442 aa AA seqDB search
MRDPQLLTVLFRSRIEKHGGDSDVTNWRRTMSGNRAVVYQGPGRVEVCDVDYPSYEVKDG
PGVNKMNVGRRTPHGAILKTVASNICGSDQHMVRGRTTAPEGLVLGHEITGEVIDVGPDV
EFIRVGDVVSVPFNISCGRCRNCKERKTGVCLNVNPDRPGSAYGYVDMGGWVGGQAAYVM
VPYADWNLLRFPDRDQALEKALDLAMLSDIFPTGYHGCVSAGVTTGSTVYIAGAGPVGLA
AATSAFLLGAAVVIVGDLNDERLAQARSFGCETINVAQGDPTEQVQQILGRSAPAIGQPL
VDAAVDAVGFEARGHGRDSGTEMPATVLNSLMDLTRAGGAIGVPGLYVTGDPGGVDEAAK
VGSLSLRLGLGWAKSHSFVTGQCPVMKYNHGLMMAILHDRVQIAKNVNATPIPMDDAPRG
YQDFDQGAARKYVLDPHGVLRR
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatccgcaactactgacggttctgttccggtcacgcatcgagaagcatggcggt
gacagcgacgtaaccaactggaggcgcaccatgtcaggcaacagagcggttgtctaccag
ggtcccggccgggtcgaggtctgcgacgtcgactacccgagctacgaggtgaaggacggc
cccggcgtcaacaagatgaacgtcgggcgcaggacaccccacggcgcgatcctcaagacg
gtcgccagcaacatctgcggcagcgaccagcacatggtccgcgggcgcaccaccgcgccg
gagggcctggtgctcggccacgagatcaccggcgaggtgatcgacgtcgggccggacgtc
gagttcatccgggtcggcgacgtggtctcggtgccgttcaacatctcctgcggcaggtgc
cgcaactgcaaggaacgcaagaccggcgtctgtctcaacgtgaacccggaccggcccggc
tcggcgtacggctacgtcgacatgggcggctgggtcggcggtcaggcggcgtacgtgatg
gttccctacgccgactggaacctgctccgcttcccggaccgcgaccaggccctggagaag
gccctggacctggcgatgctcagcgacatcttcccgaccgggtaccacggttgtgtgagc
gcgggcgtgacgaccgggtcgacggtctacatcgctggcgccggtccggtcggtctggcc
gctgcgacctcggcgttcctgctcggcgcggcggtcgtcatcgtcggtgacctcaacgac
gagcggctcgcgcaggcccgcagtttcggctgcgagacgatcaacgtggcgcagggtgat
ccgaccgagcaggtgcagcagatcctcggccgttccgcgccggcgatcggtcagccgctc
gtggacgccgcggtggacgccgtcggtttcgaggcccggggccacggccgcgactccggc
accgagatgcccgccaccgtgctgaactcgctgatggacctgacccgcgcgggcggcgcg
atcggcgtgcccggcctctacgtcaccggtgatccgggcggcgtcgacgaggccgccaag
gtcggctcgctctccctgcgactcggcctcggctgggcgaaatcgcactccttcgtgacc
ggtcagtgcccggtcatgaagtacaaccacgggctgatgatggcgatcctgcacgaccgg
gtgcagatcgcgaagaacgtcaacgccacaccgatcccgatggacgacgccccgcggggt
taccaggacttcgaccagggcgcggcgcgcaaatacgtgctcgacccgcacggcgtcctg
cgccgctag

DBGET integrated database retrieval system