KEGG   Actinoplanes missouriensis: AMIS_61540Help
Entry
AMIS_61540        CDS       T01795                                 

Definition
(GenBank) putative ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
ams  Actinoplanes missouriensis
Pathway
ams00220  Arginine biosynthesis
ams01100  Metabolic pathways
ams01110  Biosynthesis of secondary metabolites
ams01130  Biosynthesis of antibiotics
ams01230  Biosynthesis of amino acids
Module
ams_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:ams00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AMIS_61540
Enzymes [BR:ams01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     AMIS_61540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: BAL91374
UniProt: I0HED7
Position
complement(6616703..6617635)
Genome map
AA seq 310 aa AA seqDB search
MTTRHFLRDDDLTPQEQDDVLNLAAEMKANRFGHTPLAGPRSVAVFFDKASLRTRLSFEA
GIAELGGQPIIVDTQNTHFGRGETLADAGKVVSRYVAAMVFRTHGDERLAELASGVKVPV
INALSDGYHPCQLLADLLTIRERFGGTSGRTLAYVGDAANNMAHSYLIAGAMAGMNVRVA
GPSGFDPDPAVVARAAEIAAWTGGSVEVLRDPREAVDGAHVVATDTWTSMGQEEDGKDRL
TPFWPYQVNKELLAAASPDAIVLHCLPAHRGEEITDEVFDGPQSVVFDQAENRLHAQKAL
LTWLLAVNER
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacccgccacttcctccgcgacgacgacctcaccccgcaggaacaggacgacgtc
ctgaacctggccgccgagatgaaggcgaaccggttcgggcacacgccgctcgccggcccc
cgctcggtcgcggtcttcttcgacaaggccagcctgcgcacccggctctcgttcgaggcc
ggcatcgccgagctgggcggccagccgatcatcgtggacacgcagaacacccacttcggc
cgcggcgagacgctcgccgacgccggcaaggtcgtctcccggtacgtggcggcgatggtc
ttccgcacccacggcgacgagcggctcgccgagctggcgtccggcgtcaaggtcccggtg
atcaacgcgctgagcgacggttaccacccgtgccagctcctcgccgacctgctgacgatc
cgcgagcggttcggcggcacctccggccggaccctggcgtacgtgggcgacgccgctaac
aacatggcgcactcctacctgatcgccggcgcgatggccggcatgaacgtgcgggtggcc
ggcccgtccggcttcgacccggatccggccgtggtggcccgggccgccgagatcgcggcc
tggaccggcggctcggtcgaggtgctgcgcgacccgcgggaggcggtcgacggcgcgcac
gtggtcgccaccgacacctggacctcgatgggtcaggaggaggacggcaaggaccggctc
accccgttctggccgtaccaggtgaacaaggagctgctggcggccgcgagcccggacgcg
atagtgctgcactgcctgcccgcccaccgcggcgaggagatcaccgacgaggtgttcgac
ggaccgcagagcgtggtcttcgaccaggccgagaaccggctgcacgcacagaaggccctg
ctcacctggctgcttgcggtcaacgagcgatga

DBGET integrated database retrieval system