KEGG   Actinoplanes missouriensis: AMIS_76840Help
Entry
AMIS_76840        CDS       T01795                                 

Definition
(GenBank) putative low-affinity phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ams  Actinoplanes missouriensis
Brite
KEGG Orthology (KO) [BR:ams00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AMIS_76840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF4396 DUF1378 Myc_target_1 DUF2613
Motif
Other DBs
NCBI-ProteinID: BAL92904
UniProt: I0HIR7
Position
8294886..8295890
Genome map
AA seq 334 aa AA seqDB search
MDPQLVAVVAVILAAMVFDYTNGFHDAANAIATSVSTRALTPRVALLMAAVGNFVGAHLG
TEVAKTVGEDLVSLPLGIPSLGVVFAGVLGAITWNLITWYFGLPSSSSHALFGGLVGATL
MASFGEVQWGNIVNKVLIPMVFSPVVGLILGFLFMIAIMWAFRRGHPGKLNRGFRLAQTF
SAAAMAVGHGIQDAAKTMGIVVLALYTGGYQSSATHIPQWVYWASATMLALGTYAGGWRI
IRTLGRKIIDLGPAEGFAAETVASSVLYFNALVLHAPISTTHTITSAIMGVGATKRLSAV
RWNVAGNIVIAWVTTFPAAALIACLIYLVVRPLF
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
ttggatccccagctcgtcgccgtcgtggcggtgatcctcgccgcgatggtgttcgattac
accaacggcttccacgacgccgcgaacgcgatcgccaccagcgtcagcacccgcgccctg
accccacgggtcgcgctgctcatggccgccgtcggcaacttcgtcggcgcgcacctgggc
accgaggtcgccaagacggtcggtgaggacctggtctccctgccgctcggcatacccagc
ctgggcgtggtcttcgccggcgtgctcggcgcgatcacctggaacctgatcacctggtac
ttcggactgccgtcgagctcctcacacgcgctcttcggcggcttggtcggcgcgacgctc
atggcgtccttcggcgaggtgcagtggggcaacatcgtcaacaaggtcctgatcccgatg
gtgttctccccggtggtcggcctgatcctcggcttcctcttcatgatcgcgatcatgtgg
gccttccggcgcgggcaccccggcaagctgaaccgcggcttccggctcgcgcagacgttc
tccgccgccgcgatggccgtcgggcacggcatccaggacgcggcgaagaccatgggcatc
gtggtgctggcgctctacaccggcgggtaccagagctcggcgacacacatcccgcagtgg
gtctactgggcgtcggccacgatgctggcactcggcacctacgccggcggctggcggatc
atccgcaccctgggccggaagatcatcgacctggggccggccgagggtttcgccgcggag
acggtcgccagctcggtgctctacttcaacgcgctggtcctgcacgcgccgatctccacg
acgcacacgatcacctcggccatcatgggcgtcggcgcgacgaagcggctcagcgcggtc
cgctggaacgtggccggcaacatcgtgatcgcctgggtgacgacgttcccggcggccgcc
ctgatcgcctgcctcatctacctggtggtccgccccctcttctga

DBGET integrated database retrieval system