KEGG   Alkaliphilus metalliredigens: Amet_2211
Entry
Amet_2211         CDS       T00551                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00620  Pyruvate metabolism
amt00640  Propanoate metabolism
amt00650  Butanoate metabolism
amt01100  Metabolic pathways
amt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Amet_2211
   00640 Propanoate metabolism
    Amet_2211
   00650 Butanoate metabolism
    Amet_2211
Enzymes [BR:amt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Amet_2211
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ABR48369
UniProt: A6TQA1
Position
complement(2292979..2295213)
AA seq 744 aa
MMTKVFSYKTGNWSRTIDVRDFIQLNYAPYHGDASFLEKATESTKELWKQVLSLCEQERK
NNGTLDIDVDTISTIVSHKPGYIDENLEKIVGLQTDAPLKRAIMPFGGIRTVDSACQAYG
YELSSEIKDIFYKYRKTHNDGVFDVYTPEMLAARKAGIITGLPDAYGRGRIIGDYRRVAL
YGIDRLIEDKNIQLASLELDYMDENTMRLREEMAEQIRALKELKEMGKSYGFDISRPASN
AFEAIQWLYLGYLAAVKEQNGAAMSLGRVSTFLDIYIEKDLADGKLTEEQAQELVDHFVM
KLRMVRFLRTPDYNELFSGDPTWVTECIGGMSMDGRTLVTKTSYRVLNTLYNLGAAPEPN
LTVLWSTELPQNFKKFCSKASIDTSSIQYENDDLMRPYWGDDYGIACCVSAMRIGKQMQF
FGARCNLGKALLYAINGGRDEMSGLQVGPKFAPITSEYLDYQEVMEKFNTFIDWLAKLYV
NTLNVIHYMHDKYAYERIEMALHDKDILRTMACGIAGLSLCADSLSAMKYAKVKVIRNEE
GLAVDYEIEGDFPKYGNNDDRVDDLAIELVERFMNSIRRNKTYRDSIPTQSVLTITSNVV
YGKKTGSTPDGRKTGEPFAPGANPMHGRDTKGALASLASVAKLPYEHAQDGISYTFSIVP
KALGKTTEERITILSSLLDGYFVQGGHHINVNVFDRETLIDAMEHPELYPQLTIRVSGYA
VNFIKLSREQQLDVINRTFHGAIY
NT seq 2235 nt   +upstreamnt  +downstreamnt
atgatgacaaaagtatttagttacaaaacaggcaattggtctagaacaattgatgtaagg
gattttatccagttaaactatgctccatatcatggagatgcttcttttttagaaaaagcc
acagaaagtactaaagaattatggaaacaagtattgtccttatgtgaacaagaacgaaaa
aataacggtaccttggatatagatgtggatacaatttccaccatcgtttcccataagcca
ggttatatcgatgaaaacttagaaaaaatcgtcggactacaaacagatgcacccttaaag
agagcaatcatgccctttggtggaatcagaacagtggacagtgcttgtcaagcctatggt
tacgaattgagtagcgaaatcaaagatatcttttataaatatagaaaaacccataacgat
ggtgtatttgatgtctatacccctgaaatgctagccgctagaaaagctggtatcattact
ggtttgcctgacgcctacggtcgaggtcgaatcattggagactacagaagagttgccctt
tatggaatagatcgactcattgaagacaaaaatatacagcttgcttcccttgaactagac
tacatggatgaaaacaccatgaggttgagagaagaaatggcggagcaaattagagcttta
aaggagcttaaggaaatgggaaaaagctacggctttgatatctcaagaccagcttccaat
gcattcgaagcaattcaatggttgtatttagggtatctagcagcggttaaggaacaaaat
ggtgctgccatgagtttaggacgggtttctacattccttgatatttatattgaaaaggat
ctagcagatggtaaattgacagaagaacaagcccaggaattagtggaccattttgtcatg
aagcttcgaatggttagattcctgagaaccccagattacaacgagcttttcagtggggac
cccacttgggtaacagaatgtatcggtggtatgtccatggacggaagaacattggtaacc
aagacttcttatcgagttcttaatacactatataacctaggtgctgcaccagagccaaac
ttaactgttttatggtcaacagagttgcctcagaactttaaaaaattctgttcaaaggcg
tctattgataccagttctattcaatatgaaaatgacgatttaatgcgcccatactgggga
gatgattacggcattgcttgttgcgtttcagccatgcgaattggaaaacaaatgcagttc
tttggggcaagatgtaatctaggaaaagcactgctttacgcaattaatggaggtagggat
gaaatgtctggccttcaagtgggtccaaagtttgcaccaatcacatctgaatatcttgac
taccaggaggttatggaaaagtttaatactttcattgactggttagcgaagctctatgtg
aataccctaaacgtgattcactacatgcatgataagtatgcttatgagagaatcgagatg
gctttacacgataaagatattctaagaaccatggcatgcggtattgcagggttatcactt
tgtgcagattctttaagcgctatgaagtatgcaaaagtaaaagtaatccgtaacgaagaa
ggtctagctgttgattatgaaatcgaaggtgacttccctaaatacggtaataatgatgac
agggtagacgatttagccattgagctagtggagcgttttatgaattcaatcagaagaaac
aaaacatacagagattcaattcctactcagtcggtattaaccattacatctaatgttgtc
tatggtaaaaaaactggtagtactcctgacggcagaaaaacaggggaaccctttgctcct
ggagcaaatccaatgcatggcagagatacaaaaggtgctctagcctctctggcttccgtg
gctaagctaccttatgaacatgcacaggatggtatttcctataccttctcaattgttcca
aaggccttaggaaaaaccactgaggaaagaataaccatattatcttccctattggatgga
tatttcgtacagggtggccatcacattaatgtcaatgtatttgatcgagaaacattaata
gatgctatggagcatccagaactgtatccccaattaacaattcgtgtttctggatatgct
gtgaacttcattaagctatcaagagaacaacagctagacgttattaatcgaactttccat
ggagctatttattaa

DBGET integrated database retrieval system