KEGG   Alkaliphilus metalliredigens: Amet_4011
Entry
Amet_4011         CDS       T00551                                 
Name
(GenBank) conserved hypothetical protein
Organism
amt  Alkaliphilus metalliredigens
SSDB
Motif
Pfam: DUF2815
Other DBs
NCBI-ProteinID: ABR50093
UniProt: A6TV75
Position
complement(4106611..4107162)
AA seq 183 aa
MKNYTNRTKVITGVNTRLSYFHGWEPVSVNGGAEKYSVSVLIPKDDTETINAVNAAIDAA
IEEGIAKFGGKKPNKAAIKIPLRDGDVERDDEAYKGHYFINANSKTPPQIVDKSVKPIMD
RGEVYSGCYARVSLSFFAFNSNGNKGVACGLGNIQKIKDGEPLGGKSSAADDFTTLAEDD
FLA
NT seq 552 nt   +upstreamnt  +downstreamnt
atgaaaaactatacgaatagaactaaggttattacaggtgtgaacacaagactttcttac
ttccacggctgggagccggtttccgtcaacggtggtgctgaaaaatacagcgtatccgta
ctcattccaaaggacgatacagaaaccattaacgcagtaaatgctgctattgatgctgct
attgaagaaggcatcgctaagtttggtggaaagaagcccaacaaggctgctataaaaatt
cctctgcgtgatggggatgtggagcgcgatgacgaggcatataaagggcattattttatc
aatgctaacagcaaaacccctccgcagattgtagacaagagcgtaaagccaatcatggat
cgtggggaggtatacagcggctgctatgctagggtttctttgagttttttcgcattcaat
tccaacggaaataaaggtgtggcttgcggacttggcaacattcaaaagattaaagatggc
gagcctcttggtggaaagagttctgcagcagatgattttacaactcttgcagaagatgac
ttccttgcttaa

DBGET integrated database retrieval system