KEGG   Alkaliphilus metalliredigens: Amet_0375Help
Entry
Amet_0375         CDS       T00551                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00040  Pentose and glucuronate interconversions
amt00052  Galactose metabolism
amt00500  Starch and sucrose metabolism
amt00520  Amino sugar and nucleotide sugar metabolism
amt01100  Metabolic pathways
amt01130  Biosynthesis of antibiotics
Module
amt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Amet_0375
   00052 Galactose metabolism
    Amet_0375
   00500 Starch and sucrose metabolism
    Amet_0375
   00520 Amino sugar and nucleotide sugar metabolism
    Amet_0375
Enzymes [BR:amt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Amet_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABR46605
UniProt: A6TK87
Position
413899..414822
Genome map
AA seq 307 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKALPKEMLPIVDKPTLQYIIEEAVDSGIEEILIITGRNK
SSIENHFDKSIELELELEKKGKDELLKQVRAISDMVNIHYIRQKEPKGLGHAIHCAKSFI
GNEPFAVMLGDDIVENDKPCLEQMMEMYDEYKTTILGVQEVPKESVNKYGIVDGMHIEGG
IYKVKDLVEKPSPQEAPSNIAILGRYIINPEIFDILENTKPGKGGEIQLTDALKELAHRE
AMYAYVFEGRRHDVGDKQGFLEATVEFALKREDLREGFLNYLEDVVKKERESKALEEVAV
TTEQKSS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtacgtaaggcagtcataccagcagcgggattaggaacacgatttttaccggca
acaaaagcactacctaaagaaatgctaccgatcgtagacaagcctacattacaatatatt
attgaagaagctgtggattcaggtattgaagaaattctaattataacaggaagaaataaa
tcttccatagagaaccattttgataaatctatcgagcttgaactagaactagagaaaaaa
ggtaaagatgaattactaaagcaggtgagagcaatatcggatatggtgaatatccattac
ataagacaaaaagagcctaagggattaggtcatgcgatccactgtgcgaaaagctttatc
ggaaatgaaccctttgcagttatgctgggggatgatattgttgaaaatgataaaccttgt
ttggaacagatgatggagatgtatgacgagtataagaccacgatcctaggggtccaagaa
gtacctaaagagagtgtaaacaagtatggaatcgtagatggaatgcatattgagggtggc
atatacaaagtaaaggacttagtagaaaagccatctccccaggaagccccttctaatatt
gcaatcctaggaagatatattattaacccagagatatttgatatattggaaaataccaag
cctggaaagggtggagagatccaattaaccgatgccctaaaggaactagcccatagggaa
gccatgtatgcttatgtttttgaaggaagaaggcatgatgtgggagacaagcaggggttc
ttagaagcaactgtggagtttgctctgaaacgtgaagatctaagggaaggttttttaaac
tacctggaggatgttgtaaagaaggaaagagagagtaaggcattagaggaagttgccgta
acaaccgaacaaaagagcagttaa

DBGET integrated database retrieval system