KEGG   Alkaliphilus metalliredigens: Amet_0484Help
Entry
Amet_0484         CDS       T00551                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00020  Citrate cycle (TCA cycle)
amt00640  Propanoate metabolism
amt00660  C5-Branched dibasic acid metabolism
amt00720  Carbon fixation pathways in prokaryotes
amt01100  Metabolic pathways
amt01110  Biosynthesis of secondary metabolites
amt01120  Microbial metabolism in diverse environments
amt01130  Biosynthesis of antibiotics
amt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Amet_0484
   00640 Propanoate metabolism
    Amet_0484
   00660 C5-Branched dibasic acid metabolism
    Amet_0484
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Amet_0484
Enzymes [BR:amt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Amet_0484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABR46711
UniProt: A6TKJ3
Position
500230..501423
Genome map
AA seq 397 aa AA seqDB search
MNIHEYQGKEIMKQYGISVPRSRITFTVEEAVQAAIDLGCEVIAVKAQIHAGGRGKAGGV
KITRSLEETKSAAEAILDKILITKQTGPEGKVVNQVLIEEGLKIEKECYLSCAVDSTTST
VVLIGSPEGGMDIEEVAEKTPHKIFKESIDPAIGLQQYQARRLAFNMGINEACLQEAAQC
IMNIYRLFMEKDCSMVEINPLITTEEHKVVALDCKVCFDDNSLCRHPEILKYRDLTEEDP
REVQASKYDLSYISLSGNIGCMVNGAGLAMATMDMIDHFGGAPANFLDVGGGATAEKVKE
AFKILISDKKVAGIFVNIFGGIMKCDVIATGILQAVNALDLDVPLVVRLEGTNVELGKEI
LKSSWLDVITVNSMAEGAEKIVALVNGKGVVRDERLN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgaatatcaaggcaaagaaatcatgaagcaatatgggatctccgtccca
aggagcaggattacattcacagttgaagaggcggttcaagcagccatagatttagggtgt
gaggtcatagctgtcaaagcccagattcatgcgggaggtcgcggcaaagctggtggggta
aagattaccagatctttagaggagaccaaaagcgcagcagaagcaattttagataaaatc
ctcatcactaaacaaacaggaccagagggaaaggtagtcaatcaagtactcattgaagag
ggattaaaaatagaaaaagagtgttatctcagctgtgcagtagatagtacaacatctact
gtggtgctcatcggttcccctgagggaggaatggatattgaagaggtggcagagaaaacc
ccccataaaatatttaaagagtccattgatccagctattggattacagcaataccaagcc
cgtcgcctagcatttaatatgggaataaatgaagcatgcttgcaagaggcagctcaatgt
attatgaatatctatcggttgtttatggaaaaggattgttcaatggtagagatcaatcca
ctaattacaacggaggaacataaggtggtggcattagattgtaaggtatgctttgatgac
aatagcctttgtcggcatccagagattctaaaataccgtgatttgactgaagaagatcct
agggaagtccaagcatcaaaatatgatttaagctatatttctttatccggtaatattggt
tgcatggtcaatggagcgggattagccatggctaccatggatatgattgatcatttcggt
ggggcaccggccaactttttagatgttggtggtggggctacggctgaaaaggtaaaggaa
gcttttaaaatattaatttcagataaaaaggtagcgggaatatttgtaaacatatttggg
gggatcatgaaatgtgatgtcatcgccacggggattttacaggcggtaaacgcattggat
ttagatgtgcccttggtggtacggctagagggaaccaatgtggaactgggaaaagaaata
cttaaatcctcctggttagatgtgatcacggtaaattctatggcagaaggtgcagaaaag
atagtggcattagtcaatgggaaaggtgttgttagagatgagcgtcttaattga

DBGET integrated database retrieval system