KEGG   Alkaliphilus metalliredigens: Amet_0576Help
Entry
Amet_0576         CDS       T00551                                 

Definition
(GenBank) phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase
  KO
K01814  phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC:5.3.1.16]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00340  Histidine metabolism
amt01100  Metabolic pathways
amt01110  Biosynthesis of secondary metabolites
amt01230  Biosynthesis of amino acids
Module
amt_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:amt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Amet_0576
Enzymes [BR:amt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.16  1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
     Amet_0576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_biosynth Dus NMO ThiG PEP_mutase IGPS TMP-TENI NanE G3P_antiterm FMN_dh Trp_syntA NmrA Radical_SAM PcrB IMPDH
Motif
Other DBs
NCBI-ProteinID: ABR46803
UniProt: A6TKT5
Position
600650..601363
Genome map
AA seq 237 aa AA seqDB search
MIIYPAIDIQGGQCVRLTQGKKEERKMYFDSPQAVAQRWQAEGAEFIHVVDLDGAFGKGE
ENMEAIEAIVKAVEIPIQVGGGIRSIEKIQQLLDLGVTRVILGTKALTDEAFLREAIEKY
GDRIIVSIDAKEGYVATEGWVKTSSRRALDFAKSIEEIGVKRIVYTDIAKDGMLQGPNFD
EIQRMKDSVGMEVIASGGISCETDLQGLKEMDVKGVIVGKALYEGKVQLGKLRGMDI
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgatcatttatccagcaatagacattcaaggaggacagtgtgttagactgacccaggga
aaaaaagaagaacgtaaaatgtactttgattctcctcaggcagtagcccaaagatggcag
gcggagggggccgaatttatccatgtagtggatttagacggtgcctttggtaagggagaa
gagaacatggaagctattgaagccattgtgaaggcagtggagattcccattcaagtaggg
ggcggtattagaagcattgagaaaattcaacaactactagaccttggggtaacccgtgtg
attctaggaaccaaggccttaaccgacgaagcatttttaagagaggctatcgaaaaatat
ggggataggatcattgtttccattgatgccaaagagggctatgtagcaacggaaggctgg
gtgaaaaccagtagtcgaagggctttggattttgctaaatccatcgaggagataggtgtg
aaacgaattgtgtatacagatattgctaaggatggcatgctccaaggacccaactttgat
gagattcaaaggatgaaggattcagtggggatggaagtgattgcatcgggaggcatttca
tgtgaaacggatctccagggattaaaggagatggatgttaaaggggtgatcgttggaaag
gcactctatgaaggcaaggttcaactggggaaattaagggggatggatatatga

DBGET integrated database retrieval system