KEGG   Alkaliphilus metalliredigens: Amet_1083Help
Entry
Amet_1083         CDS       T00551                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00260  Glycine, serine and threonine metabolism
amt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amt01100  Metabolic pathways
amt01110  Biosynthesis of secondary metabolites
amt01130  Biosynthesis of antibiotics
amt01230  Biosynthesis of amino acids
Module
amt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Amet_1083
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Amet_1083
Enzymes [BR:amt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Amet_1083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABR47295
UniProt: A6TM77
Position
1134916..1135716
Genome map
AA seq 266 aa AA seqDB search
MISRITNKLQALKEYDEKALITYVTAGDPDLETTFDLVLAMEKAGADIIELGIPYSDPLA
DGPVIQRASQRALNAGANMEAIFELVIKLREKTQIPLVFLVYYNCVFKYGLETFLNRCQE
IGIDGLIIPDLPLEERRELQVMMQQYPMDLIPLVAPTSEDRMKEIVQDAEGFIYCVSSTG
VTGKRNSLAGNLEGFMQQLRTYTEIPLVIGFGISNSEMMDKLKNICDGFIIGSAVIEKIE
AGLEDRSSVERVSKFIEKLYEFKNLG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgataagtagaataaccaataagttgcaggcattaaaagagtatgatgagaaggcgttg
ataacctatgttactgctggagatccagatttagagacaacatttgatttggtattggca
atggagaaggcaggagcagatataatagagttagggattccttattcagatcctttagct
gatggtcccgtcatacagagggcatctcaaagagcattaaatgctggggctaatatggaa
gctatttttgaattggtcataaaattaagggaaaaaacacaaattcccctggtgttttta
gtctattataactgtgtgtttaaatatggtctagagacgtttttaaatagatgtcaggaa
atcggcatagatggattgattattccagatcttcctctagaggagagaagagaactacaa
gtgatgatgcaacaatatccaatggacctaatccctttggttgcgcctacatctgaagat
agaatgaaggaaattgtacaggatgctgaaggatttatttactgtgtttcttctactgga
gttacaggaaaaagaaatagtcttgcaggaaatctggaaggctttatgcaacaattaaga
acctatacggagatccctttggtcataggttttggtatatcaaattctgagatgatggat
aaattaaaaaacatatgtgacggtttcattataggtagtgctgtgatagagaaaattgaa
gcgggtttagaggatagaagctcagtggaaagggtttctaaatttattgaaaagttatat
gaatttaaaaacttaggttga

DBGET integrated database retrieval system