KEGG   Alkaliphilus metalliredigens: Amet_1253Help
Entry
Amet_1253         CDS       T00551                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00010  Glycolysis / Gluconeogenesis
amt00020  Citrate cycle (TCA cycle)
amt00620  Pyruvate metabolism
amt01100  Metabolic pathways
amt01110  Biosynthesis of secondary metabolites
amt01120  Microbial metabolism in diverse environments
amt01130  Biosynthesis of antibiotics
amt01200  Carbon metabolism
Module
amt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amet_1253
   00020 Citrate cycle (TCA cycle)
    Amet_1253
   00620 Pyruvate metabolism
    Amet_1253
Enzymes [BR:amt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Amet_1253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H PTS_EIIA_1 NQRA SET
Motif
Other DBs
NCBI-ProteinID: ABR47459
UniProt: A6TMP1
Position
1298588..1299904
Genome map
AA seq 438 aa AA seqDB search
MVEFKFPDIGEGISEGILTKWMVKAGDNIKEGESLCEVETDKVTTELPSPATGLVNSLKG
EEGDTIYVGDVIVKIDTGDHAEEESKNRTTSESNEKKLEKVEEEENAGVVGALEVSDEVM
GASQEARGEKAVKGQSKKVLATPVARQMAYDLGIAIGTIKGTGPLGRVMKADIKVAHERK
QQNGPLESQPKKSSMEPKEAQGQLSDKEERIKLSMLRKTIGKRMTESFYTAPHALCIDEV
DVTDLVAYREEMKNHFVEEKEIKITYLPFMIKAVMLALKDYPRFNAQLDEENQMLILKKY
YNIGIAVDTPEGLTVPVIKDVDQKGLMSLMEESVRLSQSAKDKSLKLNQLKGSTFTITNL
GSLGVKSGMPIINYPEVAIIGIGQIEQKPVVVDNEVVIRWMMPLSLSFDHRVLDGGDVGR
FLNQFKKYIKDIKGLLLR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggttgaatttaaattcccggatatcggtgaagggatttcagaagggatattaacaaaa
tggatggtgaaagctggagacaacatcaaagaaggagagtccctctgtgaagtagaaacc
gataaagtaaccacagagcttccttctccagccacaggcctggttaatagcctgaagggt
gaagagggagatacaatatatgtaggggatgtcatcgtcaaaatagacaccggtgatcac
gctgaggaagaatctaaaaaccgcacaacctctgaatcaaatgaaaagaaactggaaaag
gtagaagaagaggaaaacgctggtgttgtaggagccttagaagtatcagatgaagtcatg
ggcgccagtcaagaggccagaggagaaaaagcggtaaagggtcaaagtaaaaaagtattg
gcaacaccggttgctagacaaatggcctatgatctaggtattgccattggcacaattaaa
gggacgggaccattggggcgggtaatgaaggcagatataaaagtagctcatgaaagaaaa
caacagaatggaccattagaaagtcagcctaaaaagtcatcaatggagccgaaggaagcc
caagggcaattgagtgataaggaagagagaataaagctttccatgctacgtaaaaccatt
ggcaaacgaatgactgagtcattctataccgctccccatgccttatgcattgatgaggta
gatgtaacggatttagtagcctaccgtgaagaaatgaagaatcattttgtagaagaaaag
gagattaaaataacctatttaccatttatgattaaggcagtcatgctggcattaaaggac
tatcctagatttaatgcgcaacttgatgaagaaaatcaaatgttgatcctgaaaaagtat
tataatattgggattgcagtagatacacctgaggggctaacggttcctgttatcaaagat
gtagatcaaaaaggactgatgagcttaatggaagaaagtgtaagattgagccaaagtgcc
aaggataaaagtcttaaattaaaccagttgaaaggaagtacatttaccattaccaacttg
gggtcattgggagttaaaagtggtatgcccattattaactacccagaagtggcaataata
ggtattgggcagattgaacaaaaacccgttgtggtagataatgaagtggtcataagatgg
atgatgcccctgtctttatcctttgatcatcgggtattagacggtggagatgtgggaagg
tttttaaatcaatttaaaaaatacattaaagatattaaaggattactgttgagataa

DBGET integrated database retrieval system