KEGG   Alkaliphilus metalliredigens: Amet_1292Help
Entry
Amet_1292         CDS       T00551                                 

Definition
(GenBank) mannonate dehydratase
  KO
K01686  mannonate dehydratase [EC:4.2.1.8]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00040  Pentose and glucuronate interconversions
amt01100  Metabolic pathways
Module
amt_M00061  D-Glucuronate degradation, D-glucuronate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Amet_1292
Enzymes [BR:amt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.8  mannonate dehydratase
     Amet_1292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UxuA AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ABR47497
UniProt: A6TMS9
Position
1344324..1345391
Genome map
AA seq 355 aa AA seqDB search
MILRWFPDGDDSVTLEQIKQTPGVSGVATCLPKIPVGDVWELDVLEKLKKEINDAGLEME
VIESVNIHEDIKKGLPSRDKYINNYIKTIENLSKVGVKVLCYNFMPVIDWARSDLAHRIA
DGSSVMAYRHDEVVEMNPASMAEVMKKKARGYSLPGWEPERLKQMAIDIEIYKNMSTEAY
WENMKYFLDAVIPYAEKYDVQMAIHPDDPPWPLYGLPKVINNADNIRKFLRLNPSRYNGL
TLCTGSLGADSKNDIPAVIREFSGEGRIHFAHIRNLKHLSEKDFDESAHLSECGDLDMFE
VVKAYQDTDFDGYIRPDHGRMIWGEKARPGYGLYDRALGANYILGLWEAIEKMKK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgattttacgctggtttcctgatggagatgatagcgtgacattagagcagattaagcag
acaccaggagtatcaggagttgcaacatgtttgcccaagatacctgtgggggatgtttgg
gaactggatgttttagaaaagttgaaaaaagaaataaatgatgctggcttggagatggaa
gtaattgaaagtgtaaatatccacgaggatataaagaaaggacttccatctagagataaa
tatataaataattatataaaaaccatcgaaaatttatctaaagtgggtgtcaaggtttta
tgttataattttatgcctgtaattgattgggcacgaagtgatttagcccatcggattgca
gatggaagctcggttatggcatatagacatgatgaagtggtagaaatgaatccagctagc
atggcggaagtgatgaagaaaaaggccagaggttattccttgccaggctgggagccggaa
agactaaaacaaatggctatagatatagaaatttacaagaatatgtctactgaagcatat
tgggaaaatatgaaatatttcttggatgcagtgattccatatgctgaaaaatatgatgtt
cagatggctattcacccagatgatccaccgtggcctttatatggactaccaaaggtaatc
aacaatgcagataatatcagaaagttccttaggttgaatccaagtagatataacggtttg
actttatgtacaggaagcttaggtgccgattctaaaaatgatatcccggcagttattcgt
gagttttcaggagagggcagaatacattttgcacatatcagaaatctaaaacacctttct
gaaaaggattttgatgaatctgcacacttaagtgaatgtggcgacttggatatgttcgag
gttgtaaaggcatatcaggatactgatttcgatggctatataagaccagatcacggtaga
atgatttggggggaaaaggcccgaccaggttatggcttgtatgaccgtgccttgggtgca
aactacattttaggattatgggaagctattgaaaaaatgaaaaaataa

DBGET integrated database retrieval system