KEGG   Alkaliphilus metalliredigens: Amet_1301Help
Entry
Amet_1301         CDS       T00551                                 

Definition
(GenBank) glycoside hydrolase, family 3 domain protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00520  Amino sugar and nucleotide sugar metabolism
amt01100  Metabolic pathways
amt01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Amet_1301
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Amet_1301
Enzymes [BR:amt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Amet_1301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 DUF3096
Motif
Other DBs
NCBI-ProteinID: ABR47506
UniProt: A6TMT8
Position
1352180..1353484
Genome map
AA seq 434 aa AA seqDB search
MNWKIISMMVLIIFFATGLMACQQHNESTEEEETVLIIEEPQEGELQVEELEIEEIQIIE
GLIQEMTLEEKIGQLFMPAFRSDHEGRPLKKINESVKEQIKQYHLGGIILFAENIESIDQ
TKKLIDDMQKNSRLPMFIAVDEEGGRVTRLNHSRSQLPATQLPGNEVLGKTKDPTLSYEV
GRLLGRELLSLGFNMNLAPVADVNTNAKNPVIGDRSFSDNPQEVGIMASEMARGLQNENV
SAVFKHFPGHGDTEFDTHHQAVVINHDLERLQSVEWVPFRKGIEVSVDAIMTAHIQMPQI
TGNDFPATLSSKIITEILREEMGYEGMVITDALEMSAVSQHYTSAEAAVLAIEAGVDILL
MPRSLEEAYGGVLEAVSLGLITEERIEESVRRILQVKLKRGVLEGSQTKEDPFEVIGSAY
HAKIVKEIMNKLGR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaattggaaaatcatatcaatgatggttttaatcatattttttgccacgggtttgatg
gcatgtcagcaacacaacgagagtacagaggaagaagaaacagttttaatcatagaggaa
ccacaagaaggagaattacaagtagaagaattagaaatagaggaaatccagatcattgaa
gggttgattcaagagatgacattagaagaaaagataggtcagttgtttatgccagccttt
agaagtgatcatgaaggacgacctctaaagaaaataaatgaatcggtaaaagaacaaatc
aaacagtatcatttaggtggtatcatcttatttgctgaaaacattgaatcgattgaccag
acaaaaaaattgatcgatgacatgcaaaaaaacagtcgccttcctatgttcattgcagtc
gatgaggagggaggcagagtcacgcgattgaatcatagtcgatctcaacttcctgctact
caacttccaggaaatgaagtgctaggaaaaacaaaggatcccacactatcctatgaggta
gggcgattattgggaagagagctattatctcttggatttaatatgaatctagccccggtg
gcagatgtcaatacaaatgccaaaaatcccgtcataggagaccgttcctttagtgataat
ccccaagaagtaggaatcatggcaagtgagatggcgagaggattacaaaatgaaaatgta
agtgctgtattcaagcattttcctggacatggagatactgaatttgacacgcatcatcaa
gctgttgtcattaatcatgatttggagcggctacagtcggtagaatgggttccctttcgg
aagggaatcgaggtgagtgttgatgcaatcatgacggcccatatacaaatgccacaaata
acgggaaatgattttcccgccacgctgtctagcaagatcattacagaaatcctaagggag
gaaatgggatatgaagggatggtcattacggatgctttggaaatgtcagctgtttcccag
cattatacctcggcagaagcagcagtattagccattgaagcaggagtggatattcttttg
atgcctaggtcattagaggaggcctatgggggggtccttgaggcagtatcccttggtttg
atcactgaggaaagaatagaggaatcagttcgtaggattcttcaagttaagcttaaaaga
ggtgttttagagggatcccagactaaagaagacccatttgaggtgattggttctgcttac
catgcaaaaattgtgaaagaaataatgaataagctaggaagatag

DBGET integrated database retrieval system