KEGG   Alkaliphilus metalliredigens: Amet_1497
Entry
Amet_1497         CDS       T00551                                 

Definition
(GenBank) alkyl hydroperoxide reductase/Thiol specific antioxidant/Mal allergen
Organism
amt  Alkaliphilus metalliredigens
SSDB
Motif
Pfam: AhpC-TSA Redoxin GSHPx
Other DBs
NCBI-ProteinID: ABR47691
UniProt: A6TNC3
Position
complement(1555576..1556043)
AA seq 155 aa
MKAIEVGNHAPNFMVKDINDQNLSLADYQGKKVLLSWHPLAWTPVCTDQMRALENNWQTF
QKLNTVPLGFSVDPPPCKKAWATAILMNNVSLPSDFWPHGKVAQAYGLFNEAQGVSERAN
IIVDENGIIKWVKVYPSQQLPDINEVIQVLSNMQM
NT seq 468 nt   +upstreamnt  +downstreamnt
atgaaagcgattgaggtaggtaatcatgcaccaaatttcatggtaaaggatattaatgac
caaaacctaagtttggcagactatcaaggaaaaaaggtattactctcctggcatcctctt
gcttggacacccgtttgtactgatcagatgagggcattagagaataattggcaaacattt
cagaaactcaatacagttccccttggttttagtgttgatccgccaccctgtaaaaaagca
tgggcaacagcaatcttaatgaataacgtaagtcttccttcagacttttggccccatgga
aaagtggctcaagcgtacggtttgtttaatgaagcacaaggtgtatcagaacgggcaaat
attatcgtcgatgaaaatggtatcattaaatgggtaaaagtttatccttctcaacagtta
ccggatataaatgaagtgatacaagttctgtccaatatgcaaatgtag

DBGET integrated database retrieval system