KEGG   Alkaliphilus metalliredigens: Amet_1570
Entry
Amet_1570         CDS       T00551                                 

Definition
(GenBank) catalase/peroxidase HPI
  KO
K03782  catalase-peroxidase [EC:1.11.1.21]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00360  Phenylalanine metabolism
amt00380  Tryptophan metabolism
amt01100  Metabolic pathways
amt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Amet_1570
   00380 Tryptophan metabolism
    Amet_1570
Enzymes [BR:amt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.21  catalase-peroxidase
     Amet_1570
SSDB
Motif
Pfam: peroxidase FliD_C
Other DBs
NCBI-ProteinID: ABR47750
UniProt: A6TNI2
Position
1643119..1645311
AA seq 730 aa
MQEKGKCPVTGMTKHKTSGGTTNQDWWPNQLNLKMLHQNPTMRNPMGERFNYAEEFKKLD
FEALKNDLYALMTDSQEWWPADYGHYGPLFIRMAWHSAGTYRMGDGRGGAGTGNQRFAPL
NSWPDNVNLDKARRLLWPIKQKYGKKISWADLMILAGNCALESMGFKTFGFAGGREDIWE
PEEDIYWGQENEWLGDKRYSGDRELENPLAAVQMGLIYVNPEGPNGQPSALASGKDIRDT
FARMAMNDEETVALVAGGHTFGKCHGAGSATHVGPEPEAANIEEQGLGWKNSMGSGKGIH
TISSGIEGAWTPTPIKWDNSYLDTLFNYDWDLVKSPAGAWQWVPTDPTAADSVPDAHDPS
KRHAPMMTTADLALRMDPIYGPIAKGFRENPEAFADAFGRAWFKLTHRDMGPRTRFLGPE
VPTEELIWQDPVPAVDFELIDEDDITGLKGKIIDSGLSLSELVSTAWASASSFRGSDKRG
GANGARIRLAPQKDWEVNQPEQLQTVLQALEKIQDTFNSAQSGKKRISLADLIVLAGCAG
VEQAAKNAGFDVCVPFTPGRTDASQEQTEVESFSVLEPMADGFRNYSKGKYTISAEKLLV
DRTQLLGLTAPEMTVLVGGMRVLNANYNKSQQGVLTKRPENLTNDFFVNLLDMDTAWKVT
AEGGDMFEGIDRKTGELKWTGTGVDLVFGSNSELRAIAEVYASDDAKQKFVEDFVTAWNK
VMNADRFDLA
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgcaggaaaaaggaaaatgtccagtaacaggtatgactaagcacaagactagtggtggc
acgacaaatcaggactggtggccaaatcagttgaatcttaagatgcttcaccagaaccct
actatgagaaatcccatgggtgaaagattcaattatgctgaagaattcaagaaactcgat
tttgaggcattgaaaaatgacttatacgcattaatgacagattcacaggaatggtggcct
gcagattacgggcattatggaccacttttcatccgtatggcttggcatagtgctggcaca
tatcgtatgggagatggtcgtggcggggcggggacgggtaatcaacgctttgcgcctcta
aatagttggccagataatgtgaatcttgataaggcacgccgtttgctttggcctattaag
cagaaatacggtaaaaagatttcctgggcggatcttatgattcttgcaggtaattgcgct
ttggagtcaatgggattcaaaaccttcggttttgccggtggtcgagaggatatctgggag
cctgaagaggatatttactggggtcaagagaatgagtggcttggtgataagcgttattct
ggtgatagggaattggagaatcctcttgcagcggtgcaaatgggtctgatttatgtaaat
ccagaagggcccaatggtcaacccagtgcactggcttctggtaaagacattcgtgacact
tttgcccggatggccatgaacgacgaggagactgttgcactggttgcaggggggcatacc
ttcggtaaatgccacggcgcaggttctgccacccatgtcggcccagagcccgaggctgca
aacattgaagaacagggacttggctggaaaaacagcatgggtagtggaaaaggtatccat
accatctcaagtggcatcgaaggagcttggacccccacaccgataaaatgggacaacagc
tatttagacaccctgtttaattacgattgggatctcgttaagagtcctgctggtgcttgg
caatgggttccaactgatcctactgctgcagactctgtaccagatgcccacgacccttca
aaaaggcacgcaccaatgatgaccaccgccgaccttgccttgaggatggatcccatttat
gggcccatagccaaagggtttcgggagaacccagaggcctttgcagatgcttttggtcgg
gcatggttcaagctgactcaccgagatatgggtccccgcacccgctttcttggtccagag
gttccgactgaagagctgatctggcaagatccagtacctgcagtggattttgaactgatt
gatgaagatgatatcacaggtcttaagggtaaaattattgactcaggtttgtccctttct
gaactggtctccacagcatgggcatcagcttcgagcttcagaggctccgataaacggggt
ggggcaaatggggctcgtattcgactggcaccgcagaaagattgggaagttaaccaacca
gaacaattgcaaactgtactacaggctcttgaaaaaatccaagacaccttcaacagtgca
cagtcaggcaaaaagaggatttcccttgctgatttgattgttttagctggatgcgcaggt
gttgagcaggcagctaagaatgctggttttgatgtgtgtgttccttttaccccaggtcgc
acagatgcgtcacaagaacaaaccgaggtagagtcattttcggtacttgaaccgatggca
gatgggttccgcaactatagtaaaggcaaatataccatttctgctgaaaaactacttgtc
gatcgtacacaattgttagggttgactgccccagagatgacggttctagttggtggcatg
cgggtattaaacgctaattacaacaagtctcagcagggagtattgacaaagagacccgaa
aatcttacaaatgacttttttgtaaatctattggatatggacaccgcatggaaagtgacc
gctgaaggcggtgatatgtttgaggggatagatcgtaagactggtgaactcaaatggact
ggtactggcgttgacctggtattcggttcaaattctgagcttagggcaatcgcagaggtg
tatgcaagtgacgatgcaaaacaaaagttcgttgaggattttgtaacggcatggaataag
gtgatgaacgcagaccgtttcgaccttgcttaa

DBGET integrated database retrieval system