KEGG   Alkaliphilus metalliredigens: Amet_2370
Entry
Amet_2370         CDS       T00551                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00472  D-Arginine and D-ornithine metabolism
amt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Amet_2370
Enzymes [BR:amt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Amet_2370
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: ABR48524
UniProt: A6TQQ6
Position
2439220..2439585
AA seq 121 aa
MKRADDFQQRRAHLQDLTEEQVEQRFWDLAEKAVDPLIEMGRKYTSPSIERSVLLRMGFS
SIEAKSIVEGVMDRGLMGKGAGHVVYRLAKEKQMDIRQAGLELLEGRLWDEVMTIFNGGE
K
NT seq 366 nt   +upstreamnt  +downstreamnt
atgaaaagagcggacgattttcaacagagaagagcacatttacaggatttaacagaagag
caagtagaacaaaggttttgggatttagctgagaaagcagttgatcctttgattgaaatg
ggaagaaaatacacatctccttccattgagcgatctgttttattacgcatgggattctct
agtatagaagcgaaaagtattgttgaaggtgtaatggatcgtgggttgatgggtaaagga
gctggacatgtggtttacagattggcaaaagaaaagcaaatggacattcgacaagcaggc
cttgaattactagaaggaagactatgggacgaagtcatgaccatattcaacggaggtgaa
aaataa

DBGET integrated database retrieval system