KEGG   Alkaliphilus metalliredigens: Amet_2371
Entry
Amet_2371         CDS       T00551                                 

Definition
(GenBank) cobalamin B12-binding domain protein
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00472  D-Arginine and D-ornithine metabolism
amt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Amet_2371
Enzymes [BR:amt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Amet_2371
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding Vmethyltransf
Other DBs
NCBI-ProteinID: ABR48525
UniProt: A6TQQ7
Position
2439585..2441795
AA seq 736 aa
MELKPNEKLDIKNILEDLESYTPKRRGWTWRTKEENLSMGPFQYRDASTPLKNSVPLPSA
KYFGDIDPQPDCVITTEVASGRFEDDIRRMRMAAWHGADHIMVIRTAGQSHFDGLVEGTP
QGSGGIPITRKQVRAQRKALDMIEDEVGRPINYHSYISGVAGPEISVMFAEEGVNGAHQD
PQYNVLYRNINMLRSFVDAAEAKSAMVWADIAQIDGAHNANATAREAWKVMPELMVQHAL
NSMYSVKVGMKKENICLSTVPPTAPPAPSMTLDLPYAVALREIFKEYKMRAQMNTKYMES
STREATVTHVLNLLISKLTRAEIQSTITPDEGRNVPWHIYNIEGLDTAKQALVGMDGLMD
MIQLKDDGILREKSRELKERAVLFMEEVLEVGGYFNAVEQGFFVDSGCYPERNGDGISRK
MDGGVGAGTIYERDEDYFAPVTAHFGHNNVAQYDPSAVDNPSKLIGGCTFEKPEKIVYID
ELDEVDNVNVRLEETKELRESTHVKPEVQWMGDGIIMLNLFLPASKRVAEFTALEIAKKM
GLEDVEVIHKEVMQTSEGTRIELKGKVGFSIDTSTLVIPPEPIVMSEDEIREDIEKTPMK
VVAGTVGEDEHSVGLREIIDIKHGGIEKYGIDCHYLGTSVSLEKLVDAAIELNADAILAS
TIISHDDIHYKSMKRIHELCIEKGIRDRVMVLCGGTQVTPEKAVAQGVDAGFGRGSKGIN
VATFLIEKRREMKNED
NT seq 2211 nt   +upstreamnt  +downstreamnt
atggaactgaaacccaatgaaaagctagatatcaaaaacatattagaggacttggagtca
tatacaccgaaaagaagagggtggacttggagaacaaaagaagaaaacttatctatgggg
ccttttcaatatcgtgatgcatcaaccccactgaaaaatagtgttccattaccttcagct
aagtatttcggtgatattgaccctcaacctgactgtgtgattacaacagaggttgcttct
gggagatttgaggatgacatccgccgtatgaggatggccgcttggcatggtgctgaccat
atcatggtgattcgaactgcaggacagagtcattttgatggattagttgaaggaacacca
cagggaagcggtggtatccctattactagaaagcaagtcagagcccaaagaaaagccctg
gatatgattgaagatgaagtaggtagaccaatcaattatcattcttatattagtggtgtg
gctggaccggaaatttctgttatgtttgcagaagagggtgtgaatggcgcacatcaagat
ccccaatacaatgtgctctatcgaaacattaatatgctacgctcctttgtagatgcagca
gaggcaaaaagtgccatggtttgggcagatattgctcaaatagatggagcacataatgcc
aatgccacagctcgagaagcctggaaggttatgccagaattaatggtacagcatgcatta
aactccatgtattctgtaaaggtgggtatgaaaaaggaaaatatatgcctgtcaacggtt
ccacccacagcgccaccagcaccatcaatgaccctggatcttccctatgcagttgcacta
cgagaaatatttaaagagtacaagatgagagcccaaatgaatacaaaatatatggaatcc
tcaactcgtgaagccacggtgacacatgtattgaatttattaatctctaaattgacacgg
gcagagattcaatctaccattacgccggatgaaggaagaaatgtaccttggcatatatat
aatatcgaaggtcttgacaccgccaagcaagcattggtagggatggatggattaatggat
atgattcaattaaaggatgacggtatccttcgagagaaatcaagagaactaaaggaaaga
gctgtcttatttatggaggaagtattggaagtaggcggatacttcaatgccgtagagcag
ggattctttgttgattctggttgttaccctgaaagaaatggagatggaatctcgagaaaa
atggatggtggagtcggtgcaggaacaatttatgaacgagatgaagattattttgccccg
gttactgctcattttggacataacaatgtagcacaatacgatccttcagcagtagataac
ccatctaagctaattggtggttgtacctttgagaaaccagaaaaaatcgtttatattgat
gaattagatgaggttgataatgtaaacgtaagattagaggaaacaaaggaattaagagag
agtactcatgtgaaaccagaggtacagtggatgggagatggcataattatgcttaatctg
ttcttacctgcttccaagagagttgcagagtttactgctttagaaattgctaaaaaaatg
ggattagaggatgttgaagtcatacacaaagaagtgatgcagacatctgaaggaaccagg
atcgaattgaagggtaaggttggattttcaatcgatacctctacactggtcattccgcca
gagccaatcgttatgtcagaagatgagattcgagaagacattgaaaagactccaatgaaa
gtggtagctggaaccgtaggagaagatgagcattccgtaggattaagagaaataattgat
atcaaacacggtggtattgaaaaatatggtatcgattgtcattatctaggaacctctgtt
tccttagagaagcttgttgacgcagcgattgaattaaatgcagatgcaattctagcttct
accattatcagtcacgatgatattcactataaaagtatgaaacgaatccacgaactatgt
atcgaaaaaggaattcgtgatcgtgtgatggttttatgtggaggaacccaagtaacacct
gagaaggcggttgcacagggagttgacgctggttttggacggggaagtaaggggatcaat
gtggcgactttcctgattgaaaaaagaagagaaatgaaaaatgaagattaa

DBGET integrated database retrieval system