KEGG   Alkaliphilus metalliredigens: Amet_2790Help
Entry
Amet_2790         CDS       T00551                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
amt  Alkaliphilus metalliredigens
Pathway
amt00230  Purine metabolism
amt01100  Metabolic pathways
Module
amt_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:amt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Amet_2790
Enzymes [BR:amt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Amet_2790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_22 MMR_HSR1 ADK AAA_28 AAA_17 ABC_tran Cytidylate_kin CENP-B_N RsgA_GTPase AAA_16 cobW Thymidylate_kin NTPase_1 ATP_bind_1 Viral_helicase1
Motif
Other DBs
NCBI-ProteinID: ABR48940
UniProt: A6TRX2
Position
complement(2806843..2807445)
Genome map
AA seq 200 aa AA seqDB search
MQKQGLLIVVSGPSGAGKGTICKRLLEKNPEIKISVSATTRLPRKGEADGVNYQFLDKRK
FQEMLEKEEFLEYAQVYDNYYGTPKEYVFENLEKGYDVLLEIDIAGALQIKEEFSQGVFV
FILPPSLEELKSRIISRGTESKEDIEKRFGCALSEIQQVIKYDYAVINDNIERAIEDVEA
IIRAERCQVNRVYEQLKSRF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacaaggattattaatagtggtttcaggaccatcaggagctggtaaaggaacg
atctgtaagcgattactagaaaaaaatccagagattaagatttccgtttctgcaaccaca
agacttccaagaaaaggtgaagcagatggggtgaactatcaattcttggacaaaaggaag
tttcaggagatgcttgaaaaagaggaatttcttgaatacgctcaagtatatgataactac
tacggtacacctaaggaatatgtttttgaaaatcttgaaaaagggtatgatgtcttatta
gagatcgatatcgcaggggcattgcaaatcaaagaagaattttctcagggtgtttttgta
tttatactccctccctccttggaggaattaaaaagtcgaattatttcaaggggaacagaa
agcaaagaggatattgaaaagcgctttggatgtgctttgtcagaaattcagcaagtcatt
aaatatgattatgctgtaattaatgataatatagagcgtgcaatagaagatgttgaggct
attataagggctgaaagatgtcaagttaatcgtgtatatgaacaattgaaaagtagattt
tag

DBGET integrated database retrieval system